Recombinant Xenopus laevis Probable G-protein coupled receptor 146 (gpr146)

Shipped with Ice Packs
In Stock

Description

Functional Insights

GPR146 is an orphan receptor with no confirmed endogenous ligand, though it is hypothesized to regulate lipid metabolism through extracellular signal-regulated kinase (ERK) pathways . Key findings include:

  • Cholesterol Regulation:
    GPR146 activation in hepatocytes enhances ERK signaling, promoting sterol regulatory element-binding protein 2 (SREBP2) activity. This upregulates cholesterol biosynthesis genes (e.g., HMGCR) and increases VLDL secretion .

  • Atherosclerosis Link:
    Murine studies show Gpr146 knockout reduces plasma LDL-C and triglycerides, decreasing aortic lesions by 70–90% in LDL receptor-deficient models .

  • Immune Modulation:
    In non-specific orbital inflammation (NSOI), GPR146 correlates with immune cell infiltration, suggesting roles in inflammatory signaling .

Therapeutic Target Exploration

  • Cardiometabolic Diseases: Genetic variants (e.g., rs2362529-C) in human GPR146 associate with reduced LDL-C and coronary artery disease risk, highlighting its potential as a drug target .

  • Inflammatory Disorders: GPR146’s role in immune cell recruitment positions it as a biomarker for NSOI and diabetic retinopathy .

Comparative Analysis of GPR146 Variants

FeatureXenopus laevis GPR146Human GPR146
Amino Acid Length333 residues 364 residues
Key Domains7 transmembrane helices, His tag Extended N-terminal region
ExpressionE. coli (high yield, low cost) Mammalian systems (post-translational modifications)

Challenges and Future Directions

  • Ligand Identification: Despite advances, the natural ligand for GPR146 remains unknown, complicating mechanistic studies .

  • Species-Specific Differences: Functional insights from Xenopus models require validation in mammalian systems due to structural divergences .

  • Therapeutic Development: Small-molecule inhibitors or antibodies targeting GPR146 could mitigate hypercholesterolemia but require rigorous in vivo testing .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution. Storage at -20°C/-80°C is recommended. The default glycerol concentration for our products is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during the production process. Should you have a specific tag type in mind, please communicate it to us, and we will prioritize its inclusion in the development process.
Synonyms
gpr146; Probable G-protein coupled receptor 146
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MWSCEDLNYTNSGEEQYLCNEFHLFLFIFSVLYLIICFPVGLCYNVQLVLVNLYNKATMT MPDVYFVNMAIAGLIINAVAPVYLFGPAYTKWSLWSFGNEVYITLLILFNVSSLVIMYST TLLSLDYYIECALPRTYMSSVYNTKHVCGFIWGGAVLTSFSSLLFYICNHVSTKIIECSK MQNREAADAIMVLIGYVVPIIAVIYALVLILQIRKEATPLDQESGRLDPSVHRLLIATVC TQFILWTPYYVTLLVNTFMDARVKSSNTFYIRIFQFTEGLSNFLAFSSSFVLPLIHRHIN KNFSGKLQRLLKRLHCGSQGCTHEHTVVQQVMT
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links

KEGG: xla:398996

UniGene: Xl.5591

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why is Xenopus laevis used as a model system for GPR146 research?

Xenopus laevis (African clawed frog) offers several key advantages for GPCR research, including GPR146 studies. The retinal rod cells of Xenopus laevis can be effectively utilized as biological factories (bioreactors) for producing GPCRs in significant quantities with homogeneous quality . This approach capitalizes on the natural production system used for rhodopsin, another GPCR that is abundantly expressed in rod cells.

Methodologically, researchers have developed transgenic Xenopus systems that can generate large numbers of GPCRs with proper folding and functionality . The advantages include:

  • High expression levels comparable to native rhodopsin

  • Proper post-translational modifications, including glycosylation

  • Correct protein folding and membrane insertion

  • Scalability through automated systems capable of generating hundreds of transgenic tadpoles daily

  • Functional validation capabilities through ligand binding and G-protein coupling assays

This expression approach provides researchers with sufficient quantities of properly folded GPR146 for structural and functional studies, overcoming a major hurdle in GPCR research—the difficulty in generating purified samples of sufficient quantity and quality .

What are the optimal storage and handling conditions for recombinant GPR146?

For maintaining the structural integrity and functional properties of recombinant Xenopus laevis GPR146, the following evidence-based storage and handling protocols should be implemented:

Storage Conditions:

  • Store product at -20°C for routine storage

  • For extended storage periods, conserve at -20°C or -80°C to minimize degradation

  • Utilize 50% glycerol in Tris-based buffer for optimal protein stability

Handling Recommendations:

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • When working with the protein, prepare small working aliquots and store at 4°C for up to one week

  • For proteins in liquid form, expect a shelf life of approximately 6 months at -20°C/-80°C

  • Lyophilized forms demonstrate extended stability, with a shelf life of up to 12 months at -20°C/-80°C

These conditions are specifically optimized for maintaining the complex transmembrane structure of GPR146, preserving its native conformation and functionality for experimental applications .

What expression systems are commonly employed for GPR146 production?

Two principal expression systems have been documented for GPR146 production, each with distinct advantages for different research applications:

1. In vitro E. coli Expression System:
This bacterial system is commonly utilized for recombinant GPR146 production, offering:

  • High yield protein production

  • Cost-effectiveness and scalability

  • Capability for N-terminal tagging (typically 10xHis-tagged for purification purposes)

  • Full-length protein expression (region 1-333)

2. Transgenic Xenopus laevis System:
This eukaryotic expression approach provides:

  • Native-like post-translational modifications, particularly homogeneous glycosylation

  • Proper folding within a vertebrate membrane environment

  • Accumulation in rod outer segments, simplifying isolation

  • Functional validation through ligand binding and G-protein coupling assays

  • High-throughput production potential through automated systems

The choice between these systems depends on the research objectives. For structural studies requiring large quantities of protein, the E. coli system may be preferable. For functional studies requiring properly folded and post-translationally modified protein, the transgenic Xenopus system offers significant advantages .

What role does GPR146 play in immune responses and inflammatory conditions?

Recent research has revealed GPR146's multifaceted role in immune regulation and inflammatory pathways, particularly in non-specific orbital inflammation (NSOI). Comprehensive analysis utilizing gene expression profiling has demonstrated GPR146's significant correlation with immune cell infiltration and inflammatory processes .

Key findings regarding GPR146's immunological functions include:

  • Immune Cell Correlations: GPR146 expression shows strong positive correlation with several immune cell populations, most notably:

    • Resting mast cells

    • Plasma cells

    • Activated NK cells

    • CD8+ T cells

    • M2 macrophages

  • Inverse Correlations: Negative relationships were identified between GPR146 and:

    • M0 macrophages

    • Naive B cells

    • M1 macrophages

    • Activated mast cells

    • Various T cell subsets (memory activated CD4+, naive CD4+, gamma delta T cells)

  • Pathway Involvement: Gene Set Enrichment Analysis (GSEA) and Gene Set Variation Analysis (GSVA) identified significant enrichment of GPR146 in immune-related pathways, suggesting its role as an immunomodulatory receptor .

These findings collectively indicate that GPR146 functions as a regulatory node in the complex network of immune responses, potentially influencing the balance between pro-inflammatory and anti-inflammatory processes in conditions such as NSOI .

How can GPR146 expression analysis be utilized as a biomarker in pathological conditions?

GPR146 demonstrates significant potential as a diagnostic and prognostic biomarker, particularly in inflammatory conditions like non-specific orbital inflammation (NSOI). Advanced bioinformatic analysis has established its utility in several contexts:

Diagnostic Applications:
Analysis of GPR146 expression patterns revealed substantial differences between NSOI and normal tissue samples, with validation studies confirming high diagnostic accuracy (AUC = 0.943) . This positions GPR146 as a potentially valuable diagnostic marker, especially when integrated into multi-gene diagnostic panels.

Prognostic Value:
GPR146 expression correlates significantly with immune cell infiltration patterns, suggesting its utility in predicting disease progression and treatment response . The complex relationship between GPR146 expression and specific immune cell populations (described in question 2.1) provides a foundation for developing nuanced prognostic models.

Methodological Approach for Biomarker Validation:

  • Feature selection combining LASSO regression and support vector machine-recursive feature elimination (SVM-RFE)

  • Receiver Operating Characteristic (ROC) curve analysis to establish diagnostic accuracy

  • Correlation analysis with immune cell infiltration using CIBERSORT algorithm

  • Validation using independent datasets (e.g., GSE58331)

This comprehensive analytical framework demonstrates GPR146's potential as both a standalone biomarker and as part of integrated gene expression signatures for inflammatory conditions .

What methodological approaches are recommended for GPR146 expression and functional analysis?

A multi-tiered methodological framework is recommended for comprehensive GPR146 analysis, integrating molecular, computational, and functional approaches:

Expression Analysis:

  • Transcriptomic Profiling:

    • RNA-Seq or microarray analysis to quantify GPR146 expression levels

    • Differential expression analysis using the limma package to identify statistically significant changes between conditions

  • Network Analysis:

    • Weighted Gene Co-expression Network Analysis to identify genes co-regulated with GPR146

    • Correlation matrix generation to visualize relationships with other genes

Functional Characterization:

  • Ligand Binding Assays:

    • Purification using rhodopsin C-terminal immunoaffinity tags

    • Radioligand binding assays to confirm proper protein folding and functionality

  • G-protein Coupling:

    • [35S]GTPγS binding assays to evaluate G-protein activation

    • Functional validation through downstream signaling assays

Computational Analysis:

  • Immune Microenvironment Analysis:

    • CIBERSORT algorithm to quantify immune cell populations

    • ESTIMATE method to assess immune cell infiltration

    • Correlation analysis between GPR146 expression and immune cell distributions

  • Pathway Analysis:

    • Gene Set Enrichment Analysis (GSEA) to identify enriched pathways

    • Gene Set Variation Analysis (GSVA) to explore co-expressed gene sets

These methodological approaches provide a comprehensive framework for investigating GPR146's expression patterns, functional characteristics, and potential roles in physiological and pathological conditions .

What challenges exist in GPR146 research and what solutions have been developed?

GPR146 research faces several significant challenges that have spurred innovative methodological solutions:

Challenge 1: Protein Expression and Purification
GPCRs, including GPR146, are notoriously difficult to express and purify in sufficient quantities for structural and functional studies due to their transmembrane nature .

Solutions:

  • Development of transgenic Xenopus laevis systems that convert retina rod cells into bioreactors

  • Accumulation of receptors in rod outer segments with homogeneous glycosylation

  • Automated systems capable of generating hundreds of transgenic tadpoles daily

  • Purification strategies leveraging rhodopsin C-terminal immunoaffinity tags

Challenge 2: Functional Validation
Confirming that recombinant GPR146 maintains proper folding and functional capabilities presents significant technical hurdles.

Solutions:

  • Ligand binding assays to verify structural integrity

  • [35S]GTPγS binding assays to confirm G-protein coupling functionality

  • Integration of advanced functional readouts to assess downstream signaling

Challenge 3: Integration of Expression Data with Functional Contexts
Connecting GPR146 expression patterns to specific biological processes remains complex.

Solutions:

  • Application of sophisticated bioinformatic approaches like LASSO regression and SVM-RFE

  • Implementation of GSEA and GSVA to identify enriched pathways

  • Use of CIBERSORT algorithm to quantify immune cell composition

  • Integration of multiple datasets for cross-validation (e.g., GSE58331 and GSE105149)

These methodological innovations have significantly advanced our ability to study GPR146, although challenges remain in fully characterizing its ligands and downstream signaling pathways .

How does GPR146 interact with different immune cell populations?

Recent computational analyses have revealed a complex relationship between GPR146 expression and various immune cell types, suggesting its role in modulating the immune microenvironment:

Positive Correlations with Immune Cells:
Analysis using the CIBERSORT algorithm identified several immune cell populations that show significant positive correlation with GPR146 expression:

  • Resting Mast Cells: Strongest positive correlation, suggesting GPR146's role in mast cell homeostasis rather than activation

  • Plasma Cells: Indicating potential involvement in humoral immunity and antibody production

  • Activated NK Cells: Suggesting a relationship with innate immune surveillance mechanisms

  • CD8+ T Cells: Implicating GPR146 in cytotoxic T cell responses

  • M2 Macrophages: Highlighting potential involvement in anti-inflammatory and tissue repair processes

Negative Correlations with Immune Cells:
Conversely, several cell types demonstrated negative correlations with GPR146 expression:

  • M0 Macrophages: Unpolarized macrophages show reduced presence with higher GPR146 expression

  • Naive B Cells: Suggesting GPR146 may influence B cell differentiation or activation

  • M1 Macrophages: Indicating a potential role in balancing pro-inflammatory macrophage responses

  • Various T Cell Subsets: Including memory activated CD4+, naive CD4+, and gamma delta T cells

These correlation patterns, visualized through Lollipop plots, demonstrate GPR146's differential association with immune cell subsets. This suggests a complex immunomodulatory role, potentially influencing the balance between pro-inflammatory and anti-inflammatory responses in conditions such as NSOI .

GPR146 Expression Validation in NSOI

The following table summarizes the diagnostic accuracy of GPR146 and other hub genes in non-specific orbital inflammation based on ROC analysis:

GeneAUC Valuep-valueExpression in NSOICorrelation with Immune Infiltration
GPR1460.943<0.05IncreasedPositive
HLF0.971<0.05IncreasedPositive
PGM10.938<0.05IncreasedPositive
IRF80.851<0.05IncreasedPositive
TNS10.861<0.05IncreasedPositive
PLA2G160.839<0.05IncreasedVariable
PALMD0.867<0.05IncreasedPositive
CCL40.798<0.05IncreasedPositive
IGK0.857<0.05IncreasedPositive
CORO2B0.919<0.05IncreasedVariable
IGSF100.923<0.05IncreasedVariable
AKR1C10.810<0.05IncreasedVariable
ENPP60.882<0.05IncreasedVariable
MAP1B0.862<0.05IncreasedVariable
RHOBTB30.861<0.05IncreasedVariable

Data derived from validation analysis using GSE58331 dataset .

GPR146 Protein Specifications for Research Applications

ParameterSpecificationNotes
Protein Length333 amino acidsFull-length protein
Expression SystemE. coli in vitroAlternative: Xenopus system
Tag InformationN-terminal 10xHis-tagFor purification purposes
Storage Temperature-20°C (routine), -80°C (long-term)Avoid freeze-thaw cycles
Buffer CompositionTris-based buffer with 50% glycerolOptimized for stability
Working Storage4°CUp to one week
Shelf Life (Liquid)6 months at -20°C/-80°CDependent on storage conditions
Shelf Life (Lyophilized)12 months at -20°C/-80°CPreferred for long-term storage
UniProt IdentifierQ6P7G9For reference purposes

Data compiled from product specifications .

Correlation Between GPR146 and Immune Cell Populations

Immune Cell TypeCorrelation CoefficientRelationshipBiological Implication
Mast Cells (resting)+0.65Strong PositiveHomeostatic regulation
Plasma Cells+0.59Moderate PositiveHumoral immunity involvement
NK Cells (activated)+0.57Moderate PositiveInnate immunity regulation
T Cells CD8++0.53Moderate PositiveCytotoxic response modulation
Macrophages M2+0.48Moderate PositiveAnti-inflammatory pathway
Macrophages M0-0.42Moderate NegativeMacrophage polarization
B Cells (naive)-0.38Moderate NegativeB cell differentiation impact
Macrophages M1-0.35Moderate NegativePro-inflammatory regulation
Mast Cells (activated)-0.33Moderate NegativeInflammation control
T Cells CD4+ (memory activated)-0.29Weak NegativeAdaptive immunity modulation
T Cells CD4+ (naive)-0.27Weak NegativeT cell development
T Cells gamma delta-0.25Weak NegativeSpecialized T cell function

Data derived from CIBERSORT analysis and correlation studies .

What are the promising future directions for GPR146 research?

Current research gaps and emerging opportunities suggest several high-priority directions for GPR146 research:

  • Ligand Identification and Characterization:
    Despite progress in understanding GPR146's structure and expression patterns, its endogenous ligands remain poorly characterized. Future research should focus on identifying specific ligands and mapping binding domains through techniques such as chemical proteomics and screening approaches .

  • Structural Biology:
    Building on the expression systems described, structural determination of GPR146 through X-ray crystallography or cryo-electron microscopy would significantly advance understanding of its function. The Xenopus expression system provides a promising platform for generating sufficient quantities of properly folded protein for structural studies .

  • Therapeutic Target Validation:
    Given GPR146's implications in inflammatory conditions like NSOI, validation of its potential as a therapeutic target represents a promising research direction. This would involve developing specific agonists or antagonists and testing their effects in relevant disease models .

  • Expanded Immune Profiling:
    Further investigation of GPR146's complex relationship with immune cell populations could provide deeper insights into its immunomodulatory functions. Single-cell RNA sequencing approaches would offer higher resolution understanding of cell-specific expression patterns and responses .

  • Translational Biomarker Development:
    Building on the strong diagnostic accuracy (AUC = 0.943) demonstrated in NSOI, development and validation of GPR146-based biomarker panels for clinical application represents a promising translational direction. This would require prospective clinical studies with larger patient cohorts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.