Recombinant Xenopus laevis Probable glutathione peroxidase 8-A (gpx8-a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gpx8-a; Probable glutathione peroxidase 8-A; GPx-8-A; GSHPx-8-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
gpx8-a
Target Protein Sequence
MEPLNPYPVKFSSPKAKVSVVFLSMLLCTGILCVLQLGFLRAKGGDFYSYEVTDAKGRAV ALSKYRGKASLVVNVASGCPHAEANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNQ EIGALAKRNYGVTFPMFSKIKILGSEAEPAYRFLVDSTKKEPRWNFWKYLVDPQGQVVKY WRPDETAESIRPEVASLVRQIIMKKKEEL
Uniprot No.

Target Background

Database Links

KEGG: xla:432086

UniGene: Xl.47141

Protein Families
Glutathione peroxidase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does GPX8 catalytic mechanism differ from other glutathione peroxidases?

GPX8's catalytic mechanism differs significantly from that of selenium-containing glutathione peroxidases (GPX1-4 and GPX6). In the classic GPX1 catalytic cycle, the selenocysteine active site reacts with peroxide to form selenic acid (SE-OH), which is then reduced by two GSH molecules sequentially to regenerate the active site and produce GSSG. This process interconnects with the NADPH-dependent glutathione reductase system, forming a complete oxidation-reduction pathway .

In contrast, GPX8 uses cysteine rather than selenocysteine at its active site. This substitution results in lower peroxidase activity but appears specialized for protein folding processes in the ER. GPX8, similar to GPX7, can increase the PDI activity of ER redox protein 1 (ERO1), promoting oxidative folding of endoplasmic reticulum proteins while controlling H₂O₂ release during this process .

What is known about GPX8's subcellular localization and its significance?

GPX8 is primarily localized to the endoplasmic reticulum membrane as a type II transmembrane protein. Significantly, it is enriched in mitochondria-associated membranes (MAMs), which are critical integrating centers for calcium, lipid metabolism, and redox signaling homeostasis .

This strategic localization enables GPX8 to:

  • Regulate inter-organelle communication between the ER and mitochondria

  • Participate in oxidative protein folding within the ER

  • Modulate calcium flux between organelles

  • Control oxidative stress at the ER-mitochondria interface

The N-terminal transmembrane domain is essential for this localization and subsequent functions. Studies have demonstrated that deleting or replacing the GPX8 TMD significantly alters its ability to regulate calcium stores and fluxes, highlighting the importance of proper membrane anchoring for its biological activities .

What are the most effective methods for producing recombinant Xenopus laevis gpx8-a?

Based on published protocols, the most effective methods for producing recombinant Xenopus laevis gpx8-a include:

E. coli Expression System:

  • Clone the full-length GPX8-A sequence (1-209 aa) into an expression vector with an N-terminal His tag

  • Express in E. coli BL21(DE3) strain

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Use Tris/PBS-based buffer, pH 8.0, with 6% Trehalose for storage

  • Store as lyophilized powder or in glycerol (50%) at -20°C/-80°C

GST Fusion Protein Approach:

  • Clone GPX8-A coding sequence into pGEX-2T vector

  • Express GST-GPX8 fusion protein in E. coli BL21(DE3)

  • Purify by affinity chromatography on GSH-Sepharose

  • Optional: Remove GST tag by thrombin treatment

  • Recover purified GPX8-A protein in the wash fraction

For functional studies, researchers should consider that the transmembrane domain might affect solubility and proper folding of the recombinant protein, potentially requiring detergent solubilization or alternative expression strategies for full activity.

What strategies can validate antibodies for specificity toward Xenopus GPX8-A?

Validating antibodies for Xenopus GPX8-A requires careful consideration of the high homology between GPX family members, particularly GPX7 and GPX8. An effective validation strategy includes:

  • Production of control recombinant proteins:

    • Express and purify recombinant Xenopus GPX8-A with appropriate tags

    • Similarly produce other GPX family members (especially GPX7)

    • Use these as positive and negative controls in validation experiments

  • Western blot validation:

    • Test antibodies against all recombinant GPX proteins

    • Confirm specific recognition of GPX8-A without cross-reactivity

    • Analyze cell/tissue lysates with appropriate controls

  • Epitope selection considerations:

    • Target antibodies to regions with minimal homology to other GPX family members

    • The C-terminal region often provides better specificity than the highly conserved N-terminal regions

  • Knockdown validation:

    • Perform siRNA knockdown of GPX8-A

    • Confirm reduction/loss of antibody signal following knockdown

    • Include appropriate controls (non-targeting siRNA)

This approach was successfully used in Xenopus for synuclein proteins, where recombinant proteins were used to validate antibody specificity across highly homologous family members .

How can transgenic approaches be used to study GPX8-A in Xenopus?

Transgenic approaches offer powerful tools for studying GPX8-A function in Xenopus. Based on established protocols, the following methods are recommended:

Restriction Enzyme-Mediated Integration (REMI):

  • This efficient protocol involves three key steps:

    • Isolation of sperm nuclei using lysolecithin to permeabilize sperm plasma membranes

    • Preparation of egg extract by centrifugation and calcium treatment

    • Nuclear transplantation: combining nuclei, extract, linearized GPX8-A plasmid, and restriction enzyme

The restriction enzyme generates chromosomal breaks that promote recombination and integration of the transgene. The treated sperm nuclei are then transplanted into unfertilized eggs. Integration typically occurs before the first embryonic cleavage, resulting in non-chimeric embryos .

RNA Injection Approach:
For transient expression studies, direct injection of mRNA encoding wild-type or modified GPX8-A into Xenopus embryos can be performed. This technique allows rapid analysis of protein function during early development. Recent studies have successfully used this approach to express transgenes in the developing Xenopus laevis embryo, including targeting proteins to specific structures like cilia .

These methods enable:

  • Analysis of GPX8-A overexpression phenotypes

  • Structure-function studies using mutated or truncated versions

  • Tissue-specific expression using appropriate promoters

  • Live imaging of tagged GPX8-A proteins

  • Investigation of interactions with other proteins in vivo

How does GPX8 regulate calcium homeostasis and what methods can measure this function?

GPX8 plays a significant role in regulating calcium homeostasis, particularly at the interface between the endoplasmic reticulum and mitochondria. Key findings demonstrate that:

  • GPX8 is enriched in mitochondria-associated membranes (MAMs)

  • Overexpression of GPX8 reduces calcium storage and histamine-induced calcium release from the ER

  • Silencing GPX8 increases histamine-induced calcium release from the ER to mitochondria and cytoplasm

  • The transmembrane domain (TMD) of GPX8 is critical for this regulatory function

  • The effect may be related to interaction with inositol 1,4,5-triphosphate receptor (IP3R) and/or SERCA

Methodological approaches to measure calcium regulation:

  • Aequorin-based calcium measurements:

    • Co-transfect cells with plasmids expressing GPX8 variants and organelle-targeted aequorin probes

    • Monitor calcium levels in different cellular compartments (ER, mitochondria, cytosol)

    • Measure responses to agonists like histamine

  • Domain manipulation experiments:

    • Test calcium regulation using GPX8 variants with TMD deletions or substitutions:

      • S-GPX8: Replace N-terminal 40 amino acids with cleavable leader peptide

      • CA-TMDA-GPX8: Substitute first 40 amino acids with equivalent region from another type II transmembrane protein

      • C8-TMDA-GPX8: Replace only the TMD while keeping cytosolic N-terminal portion

  • Fluorescent calcium imaging:

    • Use calcium-sensitive dyes or genetically encoded calcium indicators

    • Monitor real-time changes in calcium distribution following GPX8 manipulation

    • Compare kinetics of calcium release and uptake between compartments

These methodologies provide a comprehensive toolkit for investigating GPX8's role in calcium homeostasis and the structural determinants of this function.

What is the relationship between GPX8 expression and cancer progression?

Multiple studies have identified significant correlations between GPX8 expression and cancer progression across different cancer types. The research indicates GPX8 may serve as both a diagnostic biomarker and therapeutic target.

Expression patterns and diagnostic value:

  • GPX8 is differentially expressed between normal and tumor tissues in multiple cancer types

  • Comprehensive analyses demonstrate moderate to high diagnostic accuracy (AUC > 0.7-0.8) for GPX8 in various cancers including breast cancer (BRCA), glioblastoma/lower-grade glioma (GBM/LGG), head and neck squamous cell carcinoma (HNSC), kidney cancers (KIRC, KIRP), and stomach adenocarcinoma (STAD)

Clinical correlations in non-small cell lung cancer (NSCLC):
GPX8 expression significantly correlates with multiple clinical features as shown in this table from a study of 219 patients:

Clinical FeatureGPX8 Expression (Low/Moderate/High)p-value
TNM stageI: 32/17/32, II: 27/20/15, IIIA: 16/15/24, IIIB: 10/0/110.026*
Tumor diameter>3 cm: 62/41/49, ≤3 cm: 23/11/330.043*
Pathological typeSCC: 51/31/12, Adenocarcinoma: 25/11/61, Others: 9/9/9<0.001*
Histological gradeWell: 24/4/11, Moderately: 52/39/54, Poorly: 9/9/170.012*

*Statistically significant correlations

Functional mechanisms in cancer:

  • GPX8 downregulation suppresses cell migration and invasion in NSCLC cell lines

  • GPX8 expression progressively increases from normal lung tissues to NSCLC without lymph node metastasis to NSCLC with lymph node metastasis

  • Pathway analyses reveal involvement in PI3K-Akt signaling, MAPK signaling, focal adhesion, and various cancer-related pathways

These findings collectively suggest GPX8 plays important roles in cancer progression through effects on cell migration, invasion, and signaling pathways critical for tumor development.

How does the transmembrane domain affect GPX8 function and how can this be tested?

The transmembrane domain (TMD) of GPX8 is critical for its proper function, particularly in calcium regulation. Research has demonstrated several key roles of the TMD:

  • Subcellular targeting: Anchors GPX8 to the ER membrane and enables enrichment in mitochondria-associated membranes (MAMs)

  • Calcium regulation: Essential for GPX8's ability to modulate ER calcium storage and release

  • Protein interactions: Likely facilitates interactions with calcium channels or pumps, such as IP3R and SERCA

Experimental approaches to test TMD function:

  • Domain manipulation experiments:
    Several elegant approaches have been developed to test TMD function:

    • S-GPX8: Replacing the N-terminal 40 amino acids (including TMD) with a cleavable leader peptide

    • CA-TMDA-GPX8: Substituting the first 40 amino acids with the N-terminal region of another type II transmembrane protein

    • C8-TMDA-GPX8: Replacing only the TMD while preserving the cytosolic N-terminal tip

    ![Diagram of GPX8 variants](https://www.example.com/gpx8_variantstructs can be analyzed by:

    • Western blotting to confirm expression

    • Immunofluorescence to verify localization

    • Calcium measurements using aequorin probes or calcium-sensitive dyes

  • Domain-swapping with GPX7:

    • Create chimeric proteins with GPX7 (which lacks a TMD)

    • Test if adding the GPX8 TMD to GPX7 confers calcium regulatory functions

    • Analyze resulting changes in localization and function

  • Functional rescue experiments:

    • Knockdown endogenous GPX8 and attempt rescue with various TMD-modified variants

    • Measure calcium dynamics to determine which functions depend on the TMD

    • Assess effects on ER stress, protein folding, and oxidative stress

These experimental approaches provide comprehensive tools for investigating how the TMD of GPX8 contributes to its various functions, particularly in calcium regulation.

How can Xenopus GPX8-A be used to model human disease-associated mutations?

Xenopus laevis provides an excellent platform for modeling human disease-associated mutations, including those in GPX8. The following methodological approach outlines how to effectively use Xenopus for this purpose:

  • Identification and characterization of human GPX8 mutations:

    • Analyze patient genomic data to identify potential disease-associated variants

    • Prioritize mutations in functional domains (active site, transmembrane domain)

    • Focus on mutations in regions conserved between human and Xenopus GPX8

  • Creation of equivalent mutations in Xenopus GPX8-A:

    • Design constructs containing Xenopus GPX8-A with mutations equivalent to human variants

    • Use site-directed mutagenesis to introduce specific mutations

    • Validate constructs through sequencing

  • Expression in Xenopus embryos:

    • mRNA injection for transient expression

    • Transgenesis approaches for stable integration using restriction enzyme-mediated integration (REMI)

    • CRISPR-Cas9 for endogenous gene editing

  • Phenotypic analysis:

    • Assess developmental consequences of GPX8-A mutations

    • Analyze cellular phenotypes (ER stress, calcium dynamics, oxidative stress)

    • Examine tissue-specific effects, particularly in tissues relevant to human disease

  • Functional rescue experiments:

    • Test if wild-type human GPX8 can rescue phenotypes caused by mutant Xenopus GPX8-A

    • Determine if human disease-associated GPX8 mutations fail to rescue the phenotype

This approach leverages the advantages of Xenopus as described in the literature:

  • Rapid, cost-effective screening of candidate genes

  • Large embryos excellent for gene overexpression and biochemical studies

  • Established toolbox of genetic manipulation techniques

  • Conserved developmental pathways relevant to human disease

Xenopus has been successfully used to investigate patient mutations in various diseases, demonstrating its potential for modeling GPX8-related disorders .

What signaling pathways are affected by GPX8 and how can they be monitored?

Research has revealed that GPX8 influences several key signaling pathways with important implications for cellular function and disease. The primary pathways affected include:

  • Receptor tyrosine kinase (RTK) signaling:

    • GPX8 depletion dramatically increases FGF-induced ERK1/2 phosphorylation (16-fold)

    • Similarly enhances insulin-induced ERK1/2 phosphorylation (12-fold)

    • Increases insulin-stimulated AKT phosphorylation (2.5-fold)

  • HIF signaling pathway:

    • GPX8 is transcriptionally regulated by HIFα

    • Preferentially responds to HIF2α binding at two functional hypoxia-response elements (HREs)

    • GPX8 HRE1 plays a major role in this regulation

  • PI3K-Akt and MAPK pathways:

    • Identified in KEGG analysis as enriched in GPX8-related differential gene expression

    • Critical for cell proliferation, differentiation, and survival

  • Calcium signaling:

    • GPX8 regulates calcium storage and release from the ER

    • Impacts numerous calcium-dependent signaling processes

Experimental methods to monitor these pathways:

  • Western blotting for phosphorylated proteins:

    • Monitor key phosphorylation events:

      • p-ERK1/2 (Thr202/Tyr204) for MAPK pathway

      • p-AKT (Ser473) for PI3K-Akt pathway

    • Compare signaling dynamics in control vs. GPX8-manipulated cells

    • Assess responses to stimuli (growth factors, insulin, hypoxia)

  • Reporter gene assays:

    • Luciferase reporter assays to study transcriptional regulation:

      • HRE-luciferase for HIF activity

      • SRE-luciferase for MAPK pathway

      • FOXO-luciferase for Akt pathway

  • Calcium signaling monitoring:

    • Aequorin-based probes targeted to different cellular compartments

    • Fluorescent calcium indicators to measure dynamic calcium changes

    • Assess responses to various stimuli (histamine, ATP)

  • Transcriptomic analysis:

    • RNA-seq to identify differentially expressed genes

    • GO and KEGG pathway analysis as described in published studies

    • Focus on genes involved in specific signaling pathways

These methodological approaches provide comprehensive tools for investigating how GPX8 influences multiple signaling pathways and the downstream functional consequences in both cell culture and in vivo models.

What are the challenges in distinguishing between GPX7 and GPX8 functions experimentally?

Distinguishing between the functions of GPX7 and GPX8 presents significant experimental challenges due to their structural and functional similarities. Understanding these challenges and applying appropriate methodology is crucial for accurate research outcomes.

Key similarities creating experimental challenges:

  • Structural and functional overlap:

    • Both GPX7 and GPX8 use cysteine (not selenocysteine) at their active sites

    • Both have low glutathione peroxidase (GSH) activity due to lack of GSH-binding domains

    • Both participate in oxidative folding of endoplasmic reticulum proteins

    • Both can enhance the PDI activity of ER redox protein 1 (ERO1)

  • Main distinguishing features:

    • GPX8: Contains a highly conserved N-terminal transmembrane domain (TMD)

    • GPX7: Lacks a TMD but contains a C-terminal KDEL ER localization sequence

    • GPX8: Enriched in mitochondria-associated membranes (MAMs) and regulates calcium fluxes

Methodological approaches to distinguish functions:

  • Domain-swapping experiments:
    Creating chimeric proteins can reveal domain-specific functions:

    • C8-TMD8-GPX7: Adding GPX8's TMD to GPX7

    • Testing constructs in calcium regulation assays to determine if TMD confers GPX8-like functions to GPX7

  • Subcellular localization studies:

    • Immunofluorescence co-staining with organelle markers

    • Subcellular fractionation followed by Western blotting

    • Super-resolution microscopy for precise localization patterns

  • Selective knockdown/knockout approaches:

    • Design siRNAs targeting unique regions of each gene

    • Validate specificity by measuring both GPX7 and GPX8 levels

    • Analyze resulting phenotypes for functional differences

  • Calcium regulation assays:

    • Compare effects of GPX7 vs. GPX8 manipulation on calcium dynamics

    • Use aequorin probes targeted to different cellular compartments

    • This approach is particularly valuable as GPX7 does not share GPX8's calcium regulation properties

These methodological approaches, when systematically applied, allow researchers to differentiate between the specific functions of GPX7 and GPX8 despite their similarities, with particular attention to the role of the transmembrane domain in determining their unique properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.