Recombinant Xenopus laevis Probable glutathione peroxidase 8-B (gpx8-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
gpx8-b; Probable glutathione peroxidase 8-B; GPx-8-B; GSHPx-8-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
gpx8-b
Target Protein Sequence
MEPLSPYPLKCSSPKAKVFLVFFSMVLCTGILCVLQLKFLRAKGGDFYSYEVTDAKGRTV ALSKYRGKASLVVNVASGCPHTEANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNK EIEAMAKRNYGVTFPVFSKIKILGSEAEPAYRFLVDSTKKEPRWNFWKYLVDPQGQVVKY WRPDETAESIRPEVASLVRQIIMKKKEDL
Uniprot No.

Target Background

Database Links

KEGG: xla:495339

UniGene: Xl.49093

Protein Families
Glutathione peroxidase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Xenopus laevis Probable glutathione peroxidase 8-B (gpx8-b) and what are its key characteristics?

Xenopus laevis Probable glutathione peroxidase 8-B (gpx8-b) is a member of the glutathione peroxidase (GPX) family identified in the African clawed frog. Based on comparative studies with mammalian GPX8, it is characterized as a type II transmembrane protein with rare structural features, consisting of approximately 209 amino acids .

GPX8-B belongs to the larger GPX family which plays crucial roles in redox homeostasis. Unlike GPX1-4 and GPX6 which use selenocysteine as their active center, GPX8-B (similar to GPX5 and GPX7) uses cysteine as its active site . This cysteine-based active site results in different catalytic mechanisms compared to selenocysteine-containing GPXs.

Key characteristics include:

  • Localization to the endoplasmic reticulum (ER)

  • Involvement in protein oxidative folding in the ER

  • Participation in regulation of calcium in the endoplasmic reticulum

  • Low glutathione peroxidase (GSH) activity due to lacking domains bound to GSH

Why is Xenopus laevis used as a model organism for studying glutathione peroxidase enzymes?

Xenopus laevis has emerged as an excellent model system for studying GPX enzymes and other proteins for several compelling reasons:

  • Experimental accessibility: Xenopus laevis produces many embryos (often thousands) that can be cultured in simple salt solutions, and eggs that can be crushed to make versatile cell-free extracts . These extracts maintain native protein interactions and provide an ideal biochemical environment for studying protein function.

  • Year-round availability: Xenopus laevis "lays eggs year-round in response to mammalian hormones, notably chorionic gonadotropin produced during pregnancy" , providing researchers with a reliable and consistent source of biological material.

  • Robust extracts: Egg extracts from Xenopus contain the soluble proteome including many factors needed to study complex biochemical processes . These extracts have been instrumental in studying DNA repair, cell cycle regulation, and protein interactions.

  • Developmental model: The large size of Xenopus embryos facilitates microinjection experiments and developmental studies that can reveal spatiotemporal expression patterns of genes like gpx8-b.

  • Cell-free systems: Xenopus egg extracts are particularly valuable for biochemical work as they yield "about five-fold more material per embryo," making them ideal for protein analysis .

It should be noted that Xenopus laevis has an allotetraploid genome resulting from hybridization of two species , which presents both challenges and opportunities for genetic studies of genes like gpx8-b.

What are the established methods for producing recombinant Xenopus laevis GPX8-B protein?

Based on established protocols for recombinant protein production from Xenopus laevis, a methodological approach for producing GPX8-B would typically involve:

Cloning and Expression System:

  • Clone the coding sequence of gpx8-b into an expression vector such as pGEX-2T to create a GST-fusion protein

  • Verify the sequence of the constructed plasmid

  • Transform the plasmid into E. coli BL21(DE3) cells for protein expression

Expression Protocol:

  • Grow transformed bacteria in LB medium with appropriate antibiotic (e.g., ampicillin) to OD600 0.5-0.6

  • Induce protein expression with 0.1 mM IPTG at 37°C for 2-3 hours

  • Harvest cells by centrifugation and store frozen at -80°C until purification

Purification Steps:

  • Resuspend cells in lysis buffer (e.g., 25 mM Mops pH 7, containing 150 mM NaCl, 1 mM PMSF, 1 mg/mL lysozyme)

  • Lyse cells by sonication and clarify lysate by centrifugation (20,000× g for 20 min)

  • Purify GST-fusion protein using GSH-Sepharose according to manufacturer's instructions

  • For tag removal, treat with thrombin and repurify on GSH-Sepharose

  • Recover purified protein in unbound and wash fractions

  • Concentrate using ultrafiltration (e.g., Vivaspin10K filters)

Quality Control:

  • Assess protein concentration using microBCA assay and spectrophotometry

  • Verify purity by SDS-PAGE

  • Confirm identity and structural integrity using methods such as circular dichroism (CD) spectroscopy and fluorescence spectroscopy

This protocol typically yields high-purity recombinant protein suitable for functional assays, antibody production, and structural studies.

What roles does GPX8-B play in Xenopus laevis cellular physiology?

Based on comparative studies with mammalian GPX8, Xenopus laevis GPX8-B likely serves multiple crucial functions in cellular physiology:

Protein Folding in the Endoplasmic Reticulum:

  • GPX8-B, like GPX7, likely increases the PDI activity of ER redox protein 1 (ERO1)

  • This promotes the oxidative folding of endoplasmic reticulum proteins and reduces oxidative stress

  • GPX8-B participates in the formation of disulfide bonds during protein maturation in the ER

Calcium Regulation:

  • GPX8-B regulates calcium levels in the endoplasmic reticulum

  • Overexpression of GPX8 reduces Ca²⁺ storage and histamine-induced Ca²⁺ release in the endoplasmic reticulum

  • When GPX8 is silenced, histamine-induced release of Ca²⁺ from the ER to mitochondria and cytoplasm increases

  • This regulation may involve interaction with the inositol 1,4,5-triphosphate receptor (IP3R)

Oxidative Stress Management:

  • GPX8-B contributes to cellular defense against oxidative stress

  • It participates in the protein oxidative folding-Nrf2-ER calcium axis mechanism (see Figure 7 in reference)

  • The transmembrane domain (TMD) of GPX8-B plays a key role in these functions

Subcellular Localization:

  • GPX8-B is enriched in mitochondria-associated membranes (MAMs)

  • MAMs are critical integrating centers for calcium, lipid metabolism, and redox signaling homeostasis

  • This strategic positioning allows GPX8-B to participate in inter-organelle communication

These diverse functions position GPX8-B as an important integrator of protein folding, calcium homeostasis, and redox signaling in Xenopus laevis cells.

What challenges does the allotetraploid genome of Xenopus laevis present when studying GPX8-B, and how can they be overcome?

Xenopus laevis possesses an allotetraploid genome resulting from hybridization of two species, which presents several significant challenges for researchers studying GPX8-B:

Gene Duplicity and Functional Redundancy:

  • The allotetraploid nature results in gene duplicates (homeologs) that "would often preclude study of mutant phenotypes"

  • GPX8-B likely exists as two homeologs (commonly designated as L and S subgenomes)

  • Functional redundancy between homeologs may mask phenotypes when only one copy is manipulated

Technical Challenges and Solutions:

ChallengeTechnical SolutionAdvantagesLimitations
Distinguishing homeologsHomeolog-specific primers or CRISPR guidesAllows targeted manipulationRequires detailed sequence knowledge
Complete gene knockoutsDesign CRISPR guides targeting conserved regions in all homeologsEliminates functional redundancyMay have off-target effects
Expression analysisRNA-seq with homeolog-specific analysisQuantifies contribution of each homeologComputationally intensive
Protein functionUse domain-specific antibodies or tagged constructsDistinguishes homeologs at protein levelMay interfere with native function

Alternative Research Strategies:

  • Utilize X. tropicalis (diploid) for initial studies, then confirm findings in X. laevis

  • Employ dominant-negative constructs that can inhibit all homeologs simultaneously

  • Use the NEXTi protocol which can target specific homeologs by carefully designing sgRNAs

  • Leverage the homeolog diversity to study subfunctionalization or neofunctionalization

As noted in the literature, "for biochemical and cell biological analysis, X. laevis will continue to be the preferred model system for proteome analysis" despite these genomic challenges, due to the abundance of material available for biochemical studies.

How can CRISPR-Cas9 technology be applied to study GPX8-B expression and function in Xenopus laevis?

The recently developed NEXTi (New and Easy Xenopus Targeted integration) protocol provides a powerful CRISPR-Cas9 approach for studying GPX8-B in Xenopus laevis:

NEXTi Knock-in Strategy for GPX8-B:

  • Target Selection: Design sgRNAs targeting the 5' UTR of the gpx8-b gene

  • Donor Construction: Create a donor plasmid containing egfp flanked by gpx8-b genomic sequences

  • Component Preparation:

    • Cas9 protein diluted to 1 μg/μL

    • sgRNA for gpx8-b 5' UTR

    • Donor DNA at 50 ng/μL

Microinjection Protocol:

  • Prepare injection mixture:

    • sgRNA solution: 6.2 μL

    • donor DNA (50 ng/μL): 1 μL

    • Cas9 protein (1 μg/μL): 2 μL

  • Incubate mixture at room temperature for 10 minutes

  • Inject 9.2 nL into animal hemisphere of fertilized eggs within 1 hour post-fertilization

  • Incubate injected embryos at 18°C for 3-4 days until tadpole stage

Based on similar experiments targeting other genes, researchers can expect approximately 2-13% of knock-in embryos showing eGFP signal in tissues where gpx8-b is expressed .

Verification and Analysis:

  • Screen embryos for tissue-specific eGFP expression

  • Extract genomic DNA from positive embryos

  • Confirm integration using PCR and sequencing

  • Raise founders to sexual maturity and establish stable lines through outcrossing

Alternative CRISPR Applications:

  • Gene Knockout: Design sgRNAs targeting exons of gpx8-b to create frameshift mutations

  • Protein Tagging: Create C-terminal fusions to study protein localization

  • Regulatory Element Analysis: Target enhancers/promoters to study transcriptional regulation

This approach allows researchers to visualize endogenous gpx8-b expression patterns, track cells expressing gpx8-b during development, and study the regulation of gpx8-b expression in various physiological contexts.

What methods are available for studying the role of GPX8-B in calcium regulation within Xenopus cells?

Given GPX8's established role in calcium regulation, several methodological approaches can be employed to study GPX8-B's specific involvement in Xenopus calcium homeostasis:

Genetic Manipulation and Calcium Imaging:

  • Overexpression Studies:

    • Microinject gpx8-b mRNA into Xenopus embryos

    • Use calcium-sensitive dyes (Fluo-4, Fura-2) or genetically encoded calcium indicators

    • Measure ER calcium stores and release dynamics

    • Expected outcome: Reduced Ca²⁺ storage and histamine-induced Ca²⁺ release

  • Knockdown/Knockout Approaches:

    • Use CRISPR-Cas9 (NEXTi) to disrupt gpx8-b expression

    • Apply morpholinos for transient knockdown

    • Monitor calcium flux between ER, mitochondria, and cytoplasm

    • Expected outcome: Increased histamine-induced Ca²⁺ release

Biochemical and Cell Biological Techniques:

TechniqueApplication to GPX8-BExpected Insights
Co-immunoprecipitationIdentify interactions with IP3R and SERCAPhysical association partners
Proximity ligation assayVisualize GPX8-B interaction with calcium channels in situSpatial organization of interactions
ER/MAM fractionationIsolate subcellular compartments containing GPX8-BCompartment-specific functions
Patch-clamp electrophysiologyMeasure calcium currents in GPX8-B manipulated cellsDirect effects on channel activity

Xenopus Egg Extract System:

  • Prepare membrane fractions from Xenopus egg extracts

  • Add or deplete GPX8-B from these fractions

  • Monitor calcium uptake/release using calcium-sensitive dyes

  • Test how oxidative stress affects GPX8-B-dependent calcium regulation

Structure-Function Analysis:

  • Generate GPX8-B constructs with mutations in key domains:

    • Transmembrane domain (TMD), which "is thought to play a key role in the regulation of Ca²⁺ signaling"

    • Active site cysteine

    • Potential interaction interfaces with IP3R or SERCA

  • Test these mutants for their ability to regulate calcium

These approaches would help elucidate the specific mechanism by which GPX8-B participates in the "protein oxidative folding-Nrf2-ER calcium axis" described in the literature .

How can the role of GPX8-B in oxidative stress response be investigated using Xenopus models?

Investigating GPX8-B's role in oxidative stress response can be approached through multiple experimental strategies using Xenopus models:

In vivo Oxidative Stress Models:

  • Embryonic Studies:

    • Generate gpx8-b knockdown/knockout embryos using CRISPR-Cas9 or morpholinos

    • Expose embryos to oxidative stressors (H₂O₂, paraquat, UV radiation)

    • Assess developmental abnormalities, survival rates, and tissue-specific damage

    • Measure redox markers (GSH/GSSG ratio, protein carbonylation, lipid peroxidation)

  • Tissue-Specific Analysis:

    • Create reporter lines using NEXTi to visualize gpx8-b expression under stress conditions

    • Expected observation: Upregulation in tissues experiencing ER stress or oxidative stress

    • Analyze how gpx8-b expression correlates with the Nrf2-Keap1 pathway activation

Cell-Free and Biochemical Approaches:

  • Xenopus Egg Extract System:

    • Add H₂O₂ or other oxidants to egg extracts with or without recombinant GPX8-B

    • Monitor protein oxidation states and folding efficiency

    • Assess downstream effects on calcium homeostasis

  • Recombinant Protein Studies:

    • Produce recombinant GPX8-B as described earlier

    • Measure its ability to reduce H₂O₂ and organic peroxides

    • Compare catalytic efficiency with other GPX family members

Molecular Pathway Analysis:

Pathway ComponentExperimental ApproachExpected Outcome in GPX8-B Deficiency
Nrf2 activationWestern blot, nuclear translocation assaysAltered response to oxidative stress
ER stress sensors (PERK, IRE1, ATF6)RT-PCR, Western blotEnhanced activation under stress
Unfolded protein response (UPR)XBP1 splicing assay, chaperone expressionIncreased UPR activation
Protein oxidative foldingNon-reducing SDS-PAGEAltered disulfide bond formation

Integrative Approaches:

  • Create a system to simultaneously monitor:

    • H₂O₂ levels (with genetically encoded H₂O₂ sensors)

    • GPX8-B activity/expression

    • ER calcium levels

    • Protein folding efficiency

  • This would allow visualization of the complete "protein oxidative folding-Nrf2-ER calcium axis mechanism" described in Figure 7 of the literature , showing how these processes are integrated in Xenopus cells.

These diverse approaches would help establish the precise role of GPX8-B in protecting Xenopus cells from oxidative stress and how this function integrates with its roles in protein folding and calcium regulation.

What are the recent advances in understanding GPX8-B structure-function relationships and how can they be applied to Xenopus research?

Recent advances in understanding GPX8 structure-function relationships provide valuable insights that can be applied to Xenopus GPX8-B research:

Key Structural Features with Functional Implications:

  • Transmembrane Topology:

    • GPX8 is a type II transmembrane protein with a single N-terminal transmembrane domain

    • The transmembrane domain is "thought to play a key role in the regulation of Ca²⁺ signaling"

    • Application: Create domain-swap experiments between GPX8-B TMD and other transmembrane proteins to identify specific residues important for calcium regulation

  • Active Site Architecture:

    • Unlike selenocysteine-containing GPXs, GPX8 uses cysteine as its active site

    • This results in different catalytic mechanisms and substrate preferences

    • Application: Site-directed mutagenesis of the active site cysteine to investigate its role in Xenopus GPX8-B function

  • Interaction Interfaces:

    • GPX8 likely interacts with SERCA to regulate Ca²⁺ in the endoplasmic reticulum

    • Application: Use proximity labeling approaches (BioID, APEX) to identify the Xenopus GPX8-B interactome

Methodological Approaches for Xenopus Research:

Advanced MethodApplication to GPX8-BExpected Insights
Cryo-EM of ER membranesVisualize GPX8-B in native membrane contextStructural organization at MAMs
HDX-MSMap dynamic regions and binding interfacesConformational changes upon substrate binding
Single-molecule FRETMonitor conformational changesResponse to redox changes and calcium fluctuations
AlphaFold2 modelingPredict Xenopus GPX8-B structureCompare with mammalian orthologs

Functional Interrogation Strategies:

  • Domain-Specific Analysis:

    • Generate chimeric proteins between GPX8-B and related GPX family members

    • Test which domains are responsible for:

      • ER localization

      • Calcium regulation

      • Protein folding enhancement

      • Redox sensing

  • Post-translational Modifications:

    • Identify potential PTM sites (phosphorylation, glycosylation)

    • Investigate how these modifications affect GPX8-B function

    • Determine if PTMs are regulated by stress conditions

  • Structural Dynamics:

    • Apply the single-molecule imaging approaches described in result #6 to study:

      • Protein stoichiometry (does GPX8-B function as a monomer or oligomer?)

      • Conformational changes during catalytic cycle

      • Binding kinetics with interaction partners

These structure-function insights can help researchers design targeted experiments to elucidate the specific mechanisms by which GPX8-B contributes to redox homeostasis, protein folding, and calcium regulation in Xenopus cells.

How can evolutionary analysis of GPX8-B across species inform functional studies in Xenopus laevis?

Evolutionary analysis of GPX8 across species provides valuable context for understanding GPX8-B function in Xenopus laevis and can guide functional studies:

Comparative Genomic Analysis:

Evolutionary Insights for Functional Studies:

Evolutionary FeatureExperimental ApproachResearch Implications
Conserved motifsTargeted mutagenesis of invariant residuesIdentify core functional elements
Lineage-specific adaptationsDomain swapping between speciesReveal specialized functions
Patterns of coevolutionCorrelation analysis with interaction partnersPredict functional interactions
Duplicate gene retentionCompare expression patterns of homeologsUnderstand selective pressures

Methodological Approaches:

  • Functional Complementation:

    • Express Xenopus GPX8-B in mammalian cells lacking GPX8

    • Test if Xenopus protein can rescue phenotypes

    • Identify functional differences between orthologs

  • Ancestral Sequence Reconstruction:

    • Infer the sequence of ancestral GPX8 proteins

    • Express these reconstructed proteins

    • Compare biochemical properties with extant GPX8-B

    • This can reveal how function has changed during evolution

  • Ecological and Physiological Context:

    • Consider the unique aspects of Xenopus biology:

      • Aquatic lifestyle

      • Metamorphosis (tadpole to adult transition)

      • Unique environmental stressors

    • These factors may have shaped GPX8-B function in species-specific ways

  • Developmental Expression Analysis:

    • Track gpx8-b expression during key developmental transitions

    • Compare with expression patterns in other vertebrates

    • Identify conserved vs. divergent expression domains

This evolutionary perspective can help researchers understand which aspects of GPX8-B function are ancient and conserved (likely core functions) versus those that are recently evolved and species-specific (likely specialized adaptations to particular ecological niches or physiological demands).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.