Recombinant Xenopus laevis Probable polyprenol reductase (srd5a3)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Identity

Recombinant Xenopus laevis Probable polyprenol reductase (srd5a3) refers to a laboratory-engineered protein derived from the African clawed frog (Xenopus laevis), representing a functional homolog of human SRD5A3. This enzyme catalyzes the reduction of polyprenol to dolichol, a critical intermediate in the biosynthesis of dolichol phosphate, which anchors oligosaccharide precursors for N-linked glycosylation . While primarily studied in humans for its role in congenital disorders of glycosylation, the recombinant Xenopus variant is used to explore conserved enzymatic mechanisms across species .

Core Enzymatic Activity

SRD5A3 reduces the terminal double bond of polyprenols to form dolichols, enabling the synthesis of dolichol phosphate (Dol-P), essential for transferring oligosaccharide chains to nascent proteins in the endoplasmic reticulum . This process ensures proper protein folding, stability, and functionality.

Research Applications

The recombinant Xenopus SRD5A3 is utilized to:

  • Study glycosylation pathways: Elucidate evolutionary conservation of N-linked glycosylation mechanisms.

  • Model enzymatic deficiencies: Investigate the impact of SRD5A3 dysfunction on protein glycosylation defects, as observed in human congenital disorders .

  • Support structural studies: Facilitate crystallization or biochemical assays to determine substrate specificity and catalytic mechanisms .

Functional Validation

Recombinant SRD5A3 from Xenopus has been confirmed to retain catalytic activity in biochemical assays, mirroring its native role in reducing polyprenols .

Glycosylation Dependency

Studies using SRD5A3 knockdown or inhibition demonstrate impaired glycosylation, leading to:

  • Defective protein secretion due to misfolded glycoproteins .

  • Accumulation of lipid-linked oligosaccharides (LLOs) in the ER, disrupting cellular homeostasis .

Disease Relevance

While Xenopus SRD5A3 itself is not directly linked to disease, its homology to human SRD5A3 underscores its utility in:

  • Cancer research: Overexpression of SRD5A3 in hepatocellular carcinoma (HCC) correlates with poor prognosis, suggesting its role in tumor progression .

  • Chemoresistance studies: In bladder cancer, SRD5A3 upregulation via m6A modification promotes cisplatin resistance .

Comparative Analysis of SRD5A3 Across Species

SpeciesKey Findings
Homo sapiensDeficiency causes congenital disorders of glycosylation (CDG1Q) .
Xenopus laevisRecombinant enzyme used to study conserved glycosylation pathways .
Mus musculusSRD5A3 knockdown in mice models reveals impaired protein glycosylation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
srd5a3; Polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3; Steroid 5-alpha-reductase 3; S5AR 3; SR type 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
srd5a3
Target Protein Sequence
MQLVQLLPPGVSLLALVWLAVDAAFLTALLLYLQRGCDSGRSLLCSVFQDLIRYGKTKSG LRRPSWLQWFDIPKRCFWHFYFVSLVWNGFLLWILLHLLLQSVPVPEWLQAVLQFLCAGS EPQVLGGELSVVLAFSLLWLHSLRRLLECLFVSIFSNGVIHFVQYCFGLGYYILIGFTIL GYCPLDRRTAVSLDDLLMQGNWYHILGLTLYVWASLHQYTCHCILADLRKSASGAIINLK HAVPTGDWFEKVSCPHYFAELLIYLSIAVVFGLLNTIWWLVVLYVLLSQALAAVLCHEFY HEKFDSYPIHRKAFIPLIF
Uniprot No.

Target Background

Function
This protein plays a critical role in the early stages of protein N-linked glycosylation. It is essential for the conversion of polyprenol to dolichol, which are necessary for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used in N-glycosylation. It functions as a NADP-dependent polyprenol reductase, catalyzing the reduction of the alpha-isoprene unit of polyprenols to dolichols. Additionally, it exhibits the ability to convert testosterone (T) to 5-alpha-dihydrotestosterone (DHT).
Database Links

KEGG: xla:379123

UniGene: Xl.15326

Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How can researchers distinguish between endogenous and recombinant Xenopus laevis srd5a3 in experimental settings?

Distinguishing between endogenous and recombinant Xenopus laevis srd5a3 requires strategic experimental approaches. One effective method is to use tagged recombinant versions of the protein. According to available product information, recombinant versions of this protein can be produced with various tags that are determined during the production process . These tags serve as molecular markers that allow differentiation from the endogenous protein.

Common approaches include:

  • Antibody-based detection: Using antibodies that specifically recognize the tag (e.g., His, FLAG, or HA) allows researchers to selectively detect the recombinant protein through Western blotting, immunoprecipitation, or immunofluorescence.

  • Size-based discrimination: The addition of tags alters the molecular weight of the recombinant protein, creating a mobility shift during gel electrophoresis that distinguishes it from the endogenous form.

  • Functional tagging: Using fluorescent protein fusions (GFP, mCherry) enables live visualization of the recombinant protein while simultaneously distinguishing it from the endogenous counterpart.

  • Expression level analysis: Recombinant protein is typically expressed at substantially higher levels than the endogenous protein, enabling quantitative differentiation through carefully calibrated assays.

What are effective CRISPR/Cas9 strategies for targeting srd5a3 in Xenopus laevis?

Implementing CRISPR/Cas9 gene editing for srd5a3 in Xenopus laevis requires careful consideration of this organism's unique genomic features and developmental biology. Xenopus laevis embryos are particularly well-suited for gene function manipulation due to their large size, external development, and accessibility for microinjection . When designing a CRISPR/Cas9 approach for srd5a3 targeting, researchers should consider the following strategic elements:

  • Guide RNA design: Select target sequences within the srd5a3 gene that have minimal off-target effects. Ideally, target early exons to ensure complete loss of function. Consider the allotetraploid nature of Xenopus laevis, which may necessitate targeting multiple alleles.

  • Injection timing and targeting: Inject CRISPR/Cas9 components at the one-cell stage for complete knockout, or target specific blastomeres (up to 32-cell stage) for tissue-specific effects . For example, researchers have successfully used similar approaches to investigate gene function in sex determination pathways in Xenopus laevis .

  • Verification methods: Employ T7 endonuclease assays, sequencing, or restriction enzyme digestion to confirm editing efficiency. Additionally, transcript analysis through RT-PCR and protein evaluation via Western blotting should be performed.

  • Phenotypic analysis: Thoroughly analyze developmental outcomes, comparing to existing developmental benchmarks for Xenopus laevis. When studying enzymes like srd5a3, functional assays for enzyme activity should be incorporated alongside morphological assessments.

Recent studies have demonstrated successful gene editing in Xenopus laevis, such as the targeted disruption of dm-w, which resulted in complete female-to-male sex reversal . Similar approaches could be applied to srd5a3 to investigate its role in development and metabolism.

How can researchers investigate post-translational modifications of srd5a3 in Xenopus laevis?

Investigation of post-translational modifications (PTMs) of srd5a3 in Xenopus laevis requires multiple complementary approaches. Drawing from studies on other Xenopus proteins, such as poly(ADP-ribose) polymerase (PARP), which undergoes regulatory phosphorylation during oocyte maturation , researchers can apply similar methodologies to investigate srd5a3 PTMs:

  • Phosphorylation analysis: Incorporate radioactive inorganic phosphate (³²P) into developing Xenopus embryos or oocytes expressing srd5a3, followed by immunoprecipitation to detect in vivo phosphorylation . This approach has successfully revealed developmental stage-specific phosphorylation of other Xenopus proteins.

  • Mobility shift assays: Changes in electrophoretic mobility can indicate PTMs, as observed with PARP, which shifts from 116 kDa to 125 kDa upon phosphorylation . Monitor srd5a3 mobility across developmental stages or in response to specific stimuli.

  • Phosphatase treatment: Treat protein extracts with bacterial or potato phosphatases to reverse potential phosphorylation events, as demonstrated with PARP . Monitor changes in both mobility and enzymatic activity of srd5a3.

  • Mass spectrometry: Apply targeted proteomic approaches to map specific modification sites on srd5a3, identifying phosphorylation, glycosylation, or other PTMs that may regulate enzyme function.

  • Mutational analysis: Generate point mutations at predicted modification sites and assess their impact on protein function and localization through microinjection of modified mRNAs into Xenopus embryos .

Different developmental stages of Xenopus laevis (oocytes, eggs, embryos) may exhibit distinct PTM patterns on srd5a3, potentially correlating with changes in enzymatic activity or protein-protein interactions. By comparing these patterns, researchers can gain insights into how srd5a3 function is regulated during development.

What approaches can be used to study the potential role of srd5a3 in Xenopus laevis sex determination pathways?

Investigating srd5a3's potential role in Xenopus laevis sex determination requires a multifaceted approach, drawing on established methodologies used to study other sex-determining genes in this model organism. Recent work on the W chromosome-specific region in Xenopus laevis provides a valuable methodological framework :

  • Gene knockout studies: Use CRISPR/Cas9 genome editing to generate srd5a3 knockout frogs, similar to the approach used for dm-w, which demonstrated that its loss causes complete female-to-male sex reversal . This would help determine if srd5a3 influences sexual development.

  • Gonadal transcriptomics: Compare gene expression profiles in developing gonads between wild-type and srd5a3-modified animals, as was done for dm-w knockout frogs to identify masculinization of genes expressed in developing gonads .

  • Fertility assessment: Evaluate reproductive capacity of srd5a3-modified animals through natural mating trials after hormone stimulation, similar to experiments showing that sex-reversed genetic females (dm-w knockouts) exhibit male sexual behavior and fertility .

  • Evolutionary analysis: Conduct targeted capture sequencing across multiple Xenopus species to explore the evolutionary history of srd5a3, as was done for sex-determining genes like dm-w, scan-w, and ccdc69-w . This can provide insights into selection pressures and functional conservation.

  • Expression pattern analysis: Map the spatiotemporal expression of srd5a3 during gonadal development using in situ hybridization or tissue-specific RT-PCR to determine if its expression correlates with key events in sex determination.

Given that steroid metabolism enzymes often play roles in sexual development, and considering that srd5a3 is related to steroid 5-alpha-reductases involved in androgen metabolism, investigating its potential contribution to sex determination is scientifically justified.

What are optimal conditions for recombinant expression and purification of Xenopus laevis srd5a3?

Optimizing recombinant expression and purification of Xenopus laevis srd5a3 requires addressing the challenges associated with membrane protein production. Based on available information about recombinant srd5a3 preparation and general approaches for Xenopus protein expression, researchers should consider the following methodological guidelines:

Expression Systems Selection:

  • Bacterial systems: E. coli-based expression may be suitable for partial domains but often results in inclusion bodies for full-length membrane proteins like srd5a3.

  • Insect cell systems: Sf9 or High Five cells often provide superior folding for complex eukaryotic proteins.

  • Mammalian expression: HEK293 or CHO cells maintain post-translational modifications and proper folding.

Optimization Parameters:

  • Construct design: Include purification tags (His, GST, or FLAG) at either N- or C-terminus, avoiding disruption of transmembrane regions .

  • Expression conditions: For insect cell expression, optimize viral titer, temperature (typically 27-28°C), and harvest time (48-72 hours post-infection).

  • Solubilization conditions: Test multiple detergents (DDM, LMNG, Triton X-100) at varying concentrations to efficiently extract srd5a3 from membranes while maintaining native conformation.

Purification Protocol:

  • Affinity chromatography: Utilize the specific tag incorporated in the recombinant protein .

  • Size exclusion chromatography: Remove aggregates and further purify monomeric protein.

  • Storage conditions: Stabilize in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage .

Quality Control Metrics:

  • Purity assessment: SDS-PAGE with Coomassie staining (>90% purity).

  • Activity testing: Enzymatic assays measuring conversion of polyprenol to dolichol.

  • Structural integrity: Circular dichroism to confirm proper folding.

The optimized recombinant protein should be stored at -20°C or -80°C, with repeated freeze-thaw cycles avoided to maintain activity . Working aliquots can be maintained at 4°C for up to one week.

What microinjection techniques are most effective for studying srd5a3 function in Xenopus embryos?

Microinjection represents a powerful technique for manipulating srd5a3 expression in Xenopus laevis embryos. Based on established protocols for Xenopus embryo manipulation, researchers should implement the following methodological approach :

Equipment and Materials:

  • Microinjector (pneumatic or electric) with precise pressure control

  • Micropipette puller for generating fine glass needles

  • Stereomicroscope with adequate magnification (20-40×)

  • Calibrated micromanipulator for needle positioning

  • Temperature-controlled incubation chamber

Injection Procedure:

  • Embryo preparation: Collect and dejelly embryos with 2% cysteine (pH 7.8-8.0) shortly after fertilization.

  • Timing optimization: For global effects, inject at the one-cell stage; for tissue-specific targeting, inject specific blastomeres up to the 32-cell stage based on established fate maps .

  • Material preparation:

    • For overexpression: Synthesize capped mRNA encoding srd5a3 (wild-type or mutant versions)

    • For knockdown: Design antisense morpholino oligonucleotides targeting the translation start site or splice junctions of srd5a3

    • For gene editing: Prepare CRISPR/Cas9 components (guide RNAs targeting srd5a3)

  • Injection volume: Typically 2-10 nl for one-cell stage, reduced proportionally for later stages

  • Concentration optimization: Test concentration series (100-500 ng/μl for mRNA; 0.25-1 mM for morpholinos)

Controls and Validation:

  • Co-injection markers: Include fluorescent tracers (e.g., GFP mRNA) at 100-200 ng/μl to confirm successful injection and track targeted cells.

  • Control injections: Perform parallel injections with non-targeting morpholinos or control mRNAs.

  • Rescue experiments: Co-inject morpholinos with morpholino-resistant mRNA to verify specificity.

  • Molecular validation: Confirm knockdown/overexpression through RT-PCR or Western blotting.

This approach enables targeted manipulation of srd5a3 expression, allowing researchers to elucidate its developmental functions through phenotypic analysis and molecular characterization of resulting embryos. The technique has been successfully applied to study various aspects of Xenopus development, including sex determination pathways .

How can enzymatic activity of Xenopus laevis srd5a3 be measured effectively?

Measuring the enzymatic activity of Xenopus laevis srd5a3 requires specialized assays that capture its function as a polyprenol reductase. Based on methodologies for related enzymes and general approaches for measuring reductase activity, researchers should consider the following protocol design:

Substrate Preparation:

  • Polyprenol substrate: Use radiolabeled (³H or ¹⁴C) polyprenol or fluorescently labeled analogs.

  • Concentration optimization: Typically 10-100 μM substrate, depending on the assay sensitivity.

  • Solubilization: Prepare substrate in appropriate detergent micelles to ensure accessibility to the membrane-bound enzyme.

Reaction Conditions:

  • Buffer composition: 100 mM Tris-HCl (pH 7.4), 1 mM EDTA, 1 mM DTT, and 0.1% Triton X-100

  • Cofactor requirements: Include 1-2 mM NADPH as electron donor

  • Reaction temperature: 25°C (room temperature) to 37°C

  • Incubation time: 30-60 minutes, with time-course sampling to establish linearity

Detection Methods:

  • Chromatographic separation: Use HPLC or TLC to separate polyprenol (substrate) from dolichol (product)

  • Radiolabel quantification: For radiolabeled substrates, scintillation counting of separated products

  • Mass spectrometry: LC-MS/MS for precise quantification of substrates and products

  • Coupled enzyme assays: Monitor NADPH oxidation spectrophotometrically at 340 nm

Data Analysis:

  • Kinetic parameters: Calculate Km and Vmax using Michaelis-Menten kinetics

  • Specific activity: Express as nmol product formed per minute per mg enzyme

  • Inhibition studies: Determine IC₅₀ values for potential inhibitors

This enzymatic activity assay can be applied to recombinant srd5a3 as well as tissue extracts from different developmental stages of Xenopus laevis, enabling comparative analysis of enzyme activity throughout development. The approach would be similar to methods used for measuring other enzymatic activities in Xenopus, such as poly(ADP-ribose) polymerase activity .

What are the best approaches for studying srd5a3 expression patterns during Xenopus laevis development?

Characterizing the expression pattern of srd5a3 during Xenopus laevis development requires integrating multiple complementary techniques. Based on established methods for studying gene expression in this model organism, researchers should implement the following approaches:

Temporal Expression Analysis:

  • RT-qPCR: Extract RNA from embryos at defined developmental stages (according to Nieuwkoop and Faber staging) and perform quantitative RT-PCR with srd5a3-specific primers. This provides precise quantification of expression changes throughout development.

  • RNA-Seq: Perform transcriptome analysis across developmental stages to place srd5a3 expression in the context of global gene expression patterns.

  • Western blotting: Analyze protein levels using srd5a3-specific antibodies to correlate transcript abundance with protein expression.

Spatial Expression Analysis:

  • Whole-mount in situ hybridization (WISH): Generate digoxigenin-labeled antisense RNA probes targeting srd5a3 mRNA to visualize expression patterns in intact embryos.

  • Section in situ hybridization: For higher resolution analysis of specific tissues, perform in situ hybridization on histological sections.

  • Immunohistochemistry: Use antibodies against srd5a3 for protein localization in tissue sections, potentially with fluorescent secondary antibodies for confocal microscopy.

Functional Reporter Systems:

  • Promoter analysis: Clone the srd5a3 promoter region upstream of a reporter gene (GFP or luciferase) and generate transgenic embryos to monitor promoter activity in vivo.

  • CRISPR knock-in: Insert fluorescent protein tags into the endogenous srd5a3 locus to track protein expression while maintaining native regulation.

This multimodal approach enables comprehensive characterization of both temporal and spatial expression patterns of srd5a3 during Xenopus development. Similar approaches have been successfully used to characterize expression patterns of developmental genes in Xenopus laevis, providing insights into their functional roles .

How can Xenopus laevis srd5a3 research inform human disease studies?

Xenopus laevis srd5a3 research offers valuable insights into human disease mechanisms, particularly congenital disorders of glycosylation (CDG) and steroid metabolism disorders. The evolutionary conservation of this enzyme makes Xenopus an informative model for translational research in the following areas:

  • Congenital Disorders of Glycosylation: Human SRD5A3 mutations cause SRD5A3-CDG, characterized by developmental delay, cerebellar ataxia, and visual impairment. Xenopus models enable investigation of developmental consequences of srd5a3 dysfunction in vertebrate embryos, which are accessible throughout development unlike mammalian embryos.

  • Developmental Mechanisms: Xenopus allows for stage-specific manipulation of srd5a3 through targeted microinjection techniques , revealing critical developmental windows when this enzyme's function is essential. This temporal information can inform potential therapeutic timing for human conditions.

  • Drug Screening Applications: The accessibility and cost-effectiveness of Xenopus embryos make them suitable for medium-throughput screening of compounds that might restore glycosylation function in srd5a3-deficient conditions.

  • Pathway Conservation Analysis: Comparative studies between Xenopus and human srd5a3 can identify conserved regulatory mechanisms and interaction partners, highlighting fundamental aspects of glycosylation pathways relevant to human disease.

The experimental advantages of Xenopus, including external development, large embryo size, and amenability to genetic manipulation , position it as an excellent complementary model to mammalian systems for studying the pathophysiology of srd5a3-related disorders. Insights from Xenopus can guide more targeted investigations in mammalian models, potentially accelerating therapeutic development.

What new technologies are emerging for investigating srd5a3 function in Xenopus laevis?

Emerging technologies are revolutionizing the study of genes like srd5a3 in Xenopus laevis, offering unprecedented precision and efficiency. These methodological advances include:

  • CRISPR/Cas Innovations:

    • Prime editing systems that enable precise base changes without double-strand breaks

    • Inducible CRISPR systems allowing temporal control of gene editing

    • Base editors for introducing specific point mutations to study structure-function relationships in srd5a3

  • Single-cell Technologies:

    • Single-cell RNA-seq to resolve cell-specific expression patterns of srd5a3 during development

    • Single-cell ATAC-seq to identify regulatory elements controlling srd5a3 expression

    • Spatial transcriptomics to map srd5a3 expression with preserved tissue architecture

  • Organoid Development:

    • Xenopus organoid systems derived from pluripotent cells to study srd5a3 function in specific tissue contexts

    • Multi-organ-on-chip approaches to investigate systemic effects of srd5a3 manipulation

  • Optical Technologies:

    • Super-resolution microscopy for subcellular localization of srd5a3

    • Optogenetic tools to control srd5a3 activity with light-inducible systems

    • Light-sheet microscopy for real-time imaging of developmental processes influenced by srd5a3

  • Computational Approaches:

    • Machine learning algorithms for predicting srd5a3 interactions and functions

    • Molecular dynamics simulations to understand enzyme mechanism and substrate binding

    • Systems biology modeling of glycosylation pathways incorporating srd5a3 activity

These emerging technologies build upon established methods for manipulating gene function in Xenopus laevis while adding new dimensions of precision, scale, and insight. They promise to enhance our understanding of srd5a3's biological roles and potentially reveal novel functions not previously appreciated through conventional approaches.

How can researchers overcome issues with recombinant srd5a3 solubility and stability?

Membrane proteins like srd5a3 present significant challenges for recombinant expression and purification. Researchers frequently encounter solubility and stability issues that can be addressed through systematic optimization:

Solubility Enhancement Strategies:

  • Fusion partners: Incorporate solubility-enhancing tags such as MBP (maltose-binding protein), GST, or SUMO.

  • Detergent screening: Systematically test a panel of detergents including:

    • Mild detergents: DDM, LMNG, or digitonin

    • Facial amphiphiles: GDN or MNA-C

    • Lipid-like detergents: CHAPSO or FOS-CHOLINE

  • Lipid supplementation: Add specific phospholipids (e.g., cholesterol, POPC, or POPE) to stabilize the native-like environment.

Stability Optimization Protocol:

  • Buffer optimization: Test pH range (6.5-8.0), ionic strength (100-500 mM NaCl), and various buffer systems (HEPES, Tris, phosphate).

  • Additive screening: Include stabilizing agents:

    • Glycerol (10-50%)

    • Reducing agents (1-5 mM DTT or TCEP)

    • Metal ions (Mg²⁺, Ca²⁺) if relevant for function

  • Temperature management: Process samples at 4°C and store at -20°C or -80°C for extended storage .

Experimental Validation Table:

Optimization ParameterTest RangeEvaluation MethodSuccess Indicator
Detergent type8-10 different detergentsSEC profile, activity assayMonodisperse peak, retained activity
Glycerol percentage0%, 10%, 25%, 50%Stability time courseMinimal activity loss over time
pH range6.5, 7.0, 7.5, 8.0Thermal shift assayIncreased melting temperature
Salt concentration150, 300, 500 mM NaClAggregation assayReduced aggregation propensity

Advanced Approaches:

  • Nanodiscs or amphipols: Reconstitute purified srd5a3 into more native-like membrane environments.

  • Construct engineering: Create truncations or chimeras to identify more stable variants while retaining functional domains.

  • Directed evolution: Generate libraries of srd5a3 variants and screen for enhanced solubility and stability.

When working with recombinant srd5a3, researchers should avoid repeated freeze-thaw cycles, which substantially reduce activity, and instead maintain working aliquots at 4°C for up to one week .

What controls are essential when studying srd5a3 function in Xenopus laevis embryos?

Implementing appropriate controls is crucial for reliable interpretation of experimental results when investigating srd5a3 function in Xenopus laevis embryos. Based on established experimental approaches in Xenopus, researchers should incorporate the following essential controls:

Genetic Manipulation Controls:

  • Morpholino controls: When using antisense morpholinos to knockdown srd5a3:

    • Standard control morpholino (non-targeting)

    • 5-base mismatch control morpholino

    • Rescue experiment with morpholino-resistant srd5a3 mRNA to confirm specificity

  • CRISPR/Cas9 controls: When employing gene editing:

    • Non-targeting gRNA controls

    • Sequencing verification of intended mutations

    • Off-target analysis at predicted sites

    • F0 mosaic analysis with multiple founders to rule out insertional effects

Expression Manipulation Controls:

  • Overexpression studies:

    • Injection of GFP or β-galactosidase mRNA as injection control

    • Dose-response analysis to establish phenotype specificity

    • Catalytically inactive srd5a3 mutant to distinguish enzymatic from structural effects

Developmental Controls:

  • Staging verification: Careful documentation of developmental stage (Nieuwkoop and Faber) for all experiments

  • Bilateral comparisons: Inject only one side of the embryo to provide an internal control

  • Sibling controls: Compare experimental embryos to uninjected siblings from the same fertilization

Technical Controls:

  • Injection quality: Co-inject lineage tracers (fluorescent dextran) to confirm targeted delivery

  • RNA quality: Verify mRNA integrity by gel electrophoresis before injection

  • Protein expression: Confirm protein production via Western blot or immunostaining

These control measures are essential for distinguishing specific srd5a3-related phenotypes from non-specific effects or technical artifacts. Similar control strategies have been successfully employed in studies of other genes in Xenopus laevis, such as investigations of the sex-determining gene dm-w , ensuring reliable and reproducible results.

What are the key unanswered questions regarding srd5a3 function in Xenopus laevis?

Despite advances in understanding Xenopus laevis srd5a3, several fundamental questions remain unresolved. These knowledge gaps represent important opportunities for future research:

  • Developmental Role Specification: While srd5a3 is presumed to function in dolichol synthesis and protein glycosylation, its precise developmental roles in Xenopus remain largely unexplored. How does srd5a3 expression correlate with specific developmental events, and which developmental processes are most sensitive to its disruption?

  • Regulatory Networks: The upstream regulators and downstream effectors of srd5a3 in Xenopus remain uncharacterized. What transcription factors control its expression during development, and how does its activity influence broader metabolic and signaling networks?

  • Evolutionary Conservation: The evolutionary history of srd5a3 across Xenopus species has not been systematically investigated. Does srd5a3 exhibit functional divergence or conservation across related species, similar to patterns observed for sex-determining genes ?

  • Tissue-Specific Functions: The relative importance of srd5a3 activity across different tissues and organs in Xenopus development is unknown. Are certain tissues more dependent on proper srd5a3 function than others?

  • Redundancy and Compensation: The existence of compensatory mechanisms or redundant enzymes that might mask phenotypes in srd5a3-deficient embryos has not been explored in Xenopus, unlike other developmental genes where redundancy has been observed.

  • Post-translational Regulation: While phosphorylation has been demonstrated to regulate other enzymes in Xenopus, such as PARP , the post-translational modifications that might regulate srd5a3 activity remain uncharacterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.