Recombinant Xenopus laevis Protein FAM168B (fam168b)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xenopus laevis Protein FAM168B (fam168b) is a protein associated with the gene FAM168B (family with sequence similarity 168, member B) . The human gene, FAM168B, is located on chromosome 2 . FAM168B is also associated with diseases such as Nonarteritic Anterior Ischemic Optic Neuropathy and Autism Spectrum Disorder .

Basic Properties

PropertyValue
Full NameFamily with sequence similarity 168, member B
Gene SymbolFAM168B
Gene ID (NCBI)130074
Calculated Molecular Weight195 aa, 20 kDa
UniProt IDA1KXE4
GenBank Accession NumberBC066347
Chromosome LocationChromosome 2

Function and Characteristics

The protein encoded by the FAM168B gene is involved in several biological processes.

  • Axonogenesis and Gene Expression Predicted to act upstream or within these processes .

  • Subcellular Location Located in the extracellular exosome .

  • Myelin-Associated Neurite-Outgrowth Inhibitor Acts as a negative regulator of CDC42 and STAT3 and a positive regulator of STMN2; positive regulator of CDC27 .

Expression and Localization

FAM168B is expressed in various human tissues and cell lines.

  • Tissue Expression Data regarding the expression profile of human genes on both the mRNA and protein level are available in the Tissue resource. Protein expression data from 44 normal tissue types are derived from antibody-based profiling using immunohistochemistry .

  • Brain Expression Gene expression in various regions of the human, mouse, and pig brain, at both the mRNA and protein levels, is described in the Brain resource .

  • Single Cell Expression RNA expression profiles in single cell types based on single cell and deconvolution of bulk transcriptomics, including RNA seq of FACS sorted immune cells, are presented in the Single Cell resource .

  • Subcellular Localization High-resolution images showing the subcellular distribution of proteins and the RNA sequencing data of various tissue culture cell lines are available in the Subcellular resource .

  • Cancer Expression mRNA and protein expression data from 17 different forms of human cancer are available in the Cancer resource .

  • Blood Resource Describes protein levels in blood in healthy persons and patients with different diseases .

Antibody Information

Antibody InformationDetails
Catalog Number24422-1-AP
HostRabbit
IsotypeIgG
ReactivityHuman
ApplicationIHC, ELISA
IHC Dilution1:20-1:200
Antigen RetrievalTE buffer pH 9.0 or citrate buffer pH 6.0
Purification MethodAntigen affinity purification
Storage BufferPBS with 0.02% sodium azide and 50% glycerol pH 7.3
Positive IHC detection inhuman cervical cancer tissue, human stomach cancer tissue

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
fam168b; Myelin-associated neurite-outgrowth inhibitor; Mani
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
fam168b
Target Protein Sequence
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYAGPNPAFQQELEHPAHVS SGVQMFMFGHAFSVARNGAIPSGYTPGTPYKVSCSPTSGTVPPYSSSPNPYQTAVYPVRS AYPQQNPYAQQGAYYTQPFYAAPPHVIHHTTVVQPNGMPATMYPAPIQSPRGNGVAMGMV AGTTMAMSAGTLLTSHYPSPVAPQVTMPTYRPPGTPTYSYVPPQW
Uniprot No.

Target Background

Function

Inhibitor of neuronal axonal outgrowth.

Database Links

KEGG: xla:779401

UniGene: Xl.3240

Protein Families
FAM168 family
Subcellular Location
Cytoplasm, perinuclear region. Cell membrane; Multi-pass membrane protein. Cell projection, axon.

Q&A

What is the optimal expression system for recombinant Xenopus laevis FAM168B protein production?

Based on successful expression of similar Xenopus laevis proteins, E. coli represents a primary choice for FAM168B expression. E. coli systems provide high yield, cost-effectiveness, and scalability for full-length protein production . For more complex applications requiring post-translational modifications, consider mammalian or insect cell expression systems. When designing your expression construct, include:

  • An appropriate fusion tag (His-tag is commonly used for Xenopus proteins)

  • Codon optimization for the expression host

  • Inclusion of protease cleavage sites if tag removal is desired

A standard purification protocol should include:

Purification StepConditionsNotes
Initial LysisBuffer with 20-50 mM Tris, pH 8.0, 300 mM NaClInclude protease inhibitors
Affinity ChromatographyIMAC for His-tagged proteinsMonitor elution profile
Size ExclusionBuffer matching experimental conditionsRemoves aggregates
Purity AssessmentSDS-PAGE, Western blot>90% purity recommended

What are the recommended storage conditions for maintaining recombinant FAM168B stability?

Lyophilized recombinant FAM168B protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use scenarios . After reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add glycerol to a final concentration of 5-50% and store in small working aliquots to avoid repeated freeze-thaw cycles . For short-term storage, working aliquots may be maintained at 4°C for up to one week. Similar to other recombinant Xenopus proteins, FAM168B stability is typically preserved in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How can inducible expression systems be utilized to study FAM168B function during Xenopus development?

For developmental studies of Xenopus proteins like FAM168B, binary inducible expression systems offer significant advantages, particularly when constitutive expression might be lethal or inhibit normal development. Two effective systems include:

  • RU-486/Mifepristone-inducible system: This system employs a modified progesterone receptor ligand-binding domain fused to GAL4 DNA-binding domain and VP16 activation domain (GLVP) . When RU-486 binds to this modified receptor, it activates transcription of your target gene (FAM168B) cloned downstream of UAS elements.

  • Tetracycline (Tet-on) inducible system: The improved Tet-on system permits induction of gene expression by adding doxycycline, with very low baseline expression and robust induction . This system is particularly valuable for developmental studies as it allows precise temporal control.

Experimental design should include:

System ComponentDescriptionConsiderations
Driver ConstructTissue-specific promoter driving the regulatory proteinChoose promoter based on tissue of interest
Responder ConstructTarget gene under control of inducible elementsInclude reporter (e.g., GFP fusion) for visualization
Induction ProtocolTiming and dosage of inducerFor RU-486: 500 ng/g body weight; For Dox: typically 50 μg/mL in water
Analysis MethodsPhenotypic analysis, molecular readoutsInclude appropriate controls (uninduced siblings)

Transgenic line establishment enables heritable inducible expression across generations, facilitating long-term studies .

What methods are recommended for studying potential interactions between FAM168B and other proteins in Xenopus development?

To investigate protein-protein interactions involving FAM168B in developmental contexts, several complementary approaches are recommended:

  • Co-immunoprecipitation (Co-IP): Using antibodies against your tagged recombinant FAM168B protein, perform pull-downs from Xenopus embryo or tissue lysates at different developmental stages. Mass spectrometry analysis of co-precipitated proteins can identify interaction partners.

  • Proximity labeling approaches: BioID or APEX2 fusions to FAM168B expressed in transgenic Xenopus can identify proteins in close proximity in living embryos.

  • Yeast two-hybrid screening: Using FAM168B as bait against a Xenopus cDNA library can identify direct binding partners.

  • Transgenic co-expression studies: Utilize the tetracycline-inducible system to co-express FAM168B with potential interaction partners tagged with different fluorophores to observe co-localization .

Each method has distinctive advantages:

MethodStrengthsLimitations
Co-IPDetects native interactionsMay miss transient interactions
Proximity labelingWorks in living embryosMay identify proximal non-interacting proteins
Yeast two-hybridDetects direct interactionsNon-physiological context
Co-expressionVisualizes spatial relationshipAssociation not proof of interaction

How can integrative omics approaches be applied to understand FAM168B function in developmental contexts?

Integrative omics approaches combining genomics, transcriptomics, and proteomics can reveal comprehensive insights into FAM168B function. This strategy allows researchers to correlate gene expression patterns with protein abundance and genetic alterations across developmental stages.

A systematic approach includes:

  • Transcriptomic profiling: RNA-seq analysis comparing wild-type and FAM168B knockdown/overexpression models at multiple developmental stages to identify differentially expressed genes.

  • ChIP-seq or CUT&RUN: If FAM168B has potential nuclear functions, chromatin immunoprecipitation can map its genomic binding sites.

  • Proteomics: Mass spectrometry-based analysis of protein complexes and post-translational modifications.

  • Integration with genomic data: Correlate expression changes with copy number alterations and single gene alterations using computational methods .

Machine learning approaches can help identify minimal gene signatures that distinguish between different experimental conditions, though careful validation is necessary as the discriminative power of such signatures doesn't always correlate with biological relevance . When designing integrative studies:

Data TypeAnalytical ApproachBiological Insight
RNA-seqDifferential expression analysisPathway enrichment, co-expression networks
ChIP-seqPeak calling, motif analysisDirect targets, regulatory mechanisms
ProteomicsProtein interaction networksFunctional complexes, signaling pathways
IntegrationCorrelation analysis, casual inferenceSystems-level understanding of protein function

What strategies should be employed to investigate potential roles of FAM168B in cell signaling pathways during Xenopus metamorphosis?

Investigating FAM168B's role in signaling during metamorphosis requires careful experimental design due to the complexity of this developmental transition. The following strategies are recommended:

  • Temporal expression analysis: Quantify FAM168B expression throughout metamorphosis using qRT-PCR and Western blotting to identify critical windows of activity.

  • Conditional manipulation: Utilize the tetracycline-inducible system to express wild-type or mutant forms of FAM168B during specific developmental windows . This approach allows precise temporal control and can reveal stage-specific functions.

  • Tissue-specific perturbation: Use neural-specific, tail-specific, or limb-specific promoters to drive expression of your inducible system components, enabling tissue-restricted functional analysis .

  • Signaling pathway analysis: Assess changes in key metamorphosis-associated pathways (especially thyroid hormone signaling) following FAM168B perturbation:

Signaling ComponentAnalytical MethodExpected Outcome if Involved
Thyroid hormone receptor (TR)TR binding assays, reporter assaysAltered transcriptional response to T3
TH-responsive genesRNA-seq, qRT-PCRExpression changes in TH target genes
Metamorphic markersImmunohistochemistryAltered timing or pattern of tissue remodeling
Signaling kinasesPhosphorylation assaysChanges in activation of signal transduction

Remember that tadpoles become competent to respond to thyroid hormone only after the second week post-fertilization , so experiments should be timed accordingly.

What are the critical quality control parameters for verifying recombinant FAM168B protein functionality?

Ensuring proper folding and functionality of recombinant FAM168B requires rigorous quality control:

  • Purity assessment: SDS-PAGE analysis should demonstrate >90% purity, with a single predominant band at the expected molecular weight .

  • Western blot verification: Confirmation of identity using specific antibodies against FAM168B or the fusion tag.

  • Secondary structure analysis: Circular dichroism (CD) spectroscopy to verify proper folding.

  • Functional assays: Based on predicted function, design activity assays appropriate for FAM168B:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE with Coomassie staining>90% purity
IdentityWestern blot, mass spectrometryConfirmation of sequence and MW
HomogeneitySize exclusion chromatographySingle predominant peak
ActivityProtein-specific functional assayActivity comparable to standard

For storage stability assessment, analyze aliquots after various storage durations to ensure consistent performance in functional assays.

How should researchers address experimental variability when working with Xenopus laevis FAM168B in developmental studies?

Controlling experimental variability in Xenopus developmental studies requires systematic approaches:

  • Genetic background standardization: Use siblings from the same mating pair whenever possible and maintain well-characterized laboratory strains.

  • Environmental control: Maintain consistent temperature, light cycles, and water quality parameters across experiments.

  • Staging precision: Utilize the Nieuwkoop and Faber (NF) staging system with careful documentation of developmental landmarks .

  • Statistical considerations:

Source of VariabilityMitigation StrategyStatistical Approach
Developmental timingPrecise staging, synchronized fertilizationTime-series analysis
Individual variationIncrease biological replicatesPower analysis for sample size determination
Technical variationStandardized protocols, multiple technical replicatesNested ANOVA to partition variance sources
Transgene expressionReporter co-expression, quantitative assessmentCorrelation analysis between expression and phenotype

For inducible systems, establish dose-response relationships for your inducer (RU-486 or doxycycline) to enable consistent transgene expression levels . When comparing phenotypes between experimental groups, blind analysis prevents unconscious bias in scoring.

How might single-cell approaches enhance our understanding of FAM168B function in Xenopus laevis?

Single-cell technologies offer unprecedented resolution for studying protein function in heterogeneous tissues during development:

  • scRNA-seq applications: Single-cell transcriptomics can reveal cell-type specific responses to FAM168B perturbation, particularly valuable during metamorphosis when diverse cell populations undergo distinct fates.

  • Spatial transcriptomics: Techniques like Slide-seq or Visium can map transcriptional changes associated with FAM168B manipulation while preserving spatial context.

  • CRISPR screens: Single-cell CRISPR screens combined with scRNA-seq readouts can identify genetic interactions with FAM168B.

  • Lineage tracing: Combined with inducible FAM168B expression systems, lineage tracing can determine how FAM168B affects cell fate decisions.

TechnologyApplication to FAM168B ResearchExpected Insight
scRNA-seqCell-type specific responses to perturbationIdentification of primary vs. secondary effects
Spatial transcriptomicsLocalized gene expression changesTissue-specific functions in metamorphic reorganization
Live imaging + inducible expressionDynamic cellular behaviorsImmediate vs. delayed responses to FAM168B
Single-cell proteomicsProtein-level changesPost-transcriptional regulation mechanisms

These approaches will help distinguish cell-autonomous effects from non-cell-autonomous consequences of FAM168B perturbation.

What are the most promising approaches for elucidating potential roles of FAM168B in disease models based on Xenopus systems?

Xenopus models offer unique advantages for disease modeling that can be leveraged to study FAM168B's role in pathological conditions:

  • Cancer models: If FAM168B is implicated in signaling relevant to cancer (like many developmental proteins), researchers can use the inducible expression systems to study its effects on cell proliferation, migration, and invasion in Xenopus tissues .

  • Neurodevelopmental disorders: The binary inducible systems can express FAM168B specifically in neural tissues to study potential impacts on neural development and circuit formation .

  • Metamorphosis as a model for hormone-dependent processes: Thyroid hormone-dependent metamorphosis provides a powerful context to study FAM168B in hormone signaling pathways relevant to endocrine disorders .

Research strategies might include:

Disease ContextExperimental ApproachTranslational Relevance
Cancer biologyInducible expression in specific tissuesInsights into signaling pathway interactions and cellular behaviors
Developmental disordersTemporal perturbation during critical windowsUnderstanding timing of developmental requirements
Regenerative medicineExpression during tail or limb regenerationPotential regenerative applications
Drug screeningSmall molecule modifiers of FAM168B phenotypesTarget validation and therapeutic development

Additionally, CRISPR-Cas9 gene editing can generate disease-specific mutations in the Xenopus FAM168B gene to model human conditions, while the relatively rapid development of Xenopus facilitates higher-throughput screening approaches compared to mammalian models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.