Recombinant Xenopus laevis Protein FAM173B (fam173b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpsckmt; fam173b; ATP synthase subunit C lysine N-methyltransferase; Protein N-lysine methyltransferase FAM173B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
fam173b
Target Protein Sequence
MSKSRKESKSLEEYSIVSSTSRPKKKKWGLVATGVIGGTLVALYAVATPFVAPALRKLCL PYVPATTTQVKNVLKMLRSRTGIVVDIGSGDGRIVIAAAKEGFQAVGYELNPWLVWYSRF RAWREGVHHHTRFYVSDLWKVSFSRYRNVVIFGVPQMMPQLEKKLQTELQDAARVIACRF PFPNWVPDHIFGEGVDTVWTYDLGAFRKVSDLKQVASKHCILDTTV
Uniprot No.

Target Background

Function

Recombinant Xenopus laevis Protein FAM173B (fam173b) is a mitochondrial protein-lysine N-methyltransferase implicated in chronic pain. It plays a role in persistent inflammatory and neuropathic pain, where its mitochondrial methyltransferase activity in sensory neurons promotes chronic pain. This process is dependent on reactive oxygen species (ROS) production and the activation of spinal cord microglia. Its activity is also reliant on S-adenosyl-L-methionine.

Database Links

KEGG: xla:496288

UniGene: Xl.29791

Protein Families
FAM173 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

How is FAM173B targeted to mitochondria in Xenopus laevis compared to mammalian orthologs?

Xenopus laevis FAM173B, similar to its mammalian counterparts, contains an atypical, noncleavable mitochondrial targeting sequence. Unlike classic mitochondrial targeting sequences that are cleaved during import, FAM173B contains a conserved transmembrane domain (TMD) in its N-terminal portion followed by a conserved sequence segment (preMT) that precedes the methyltransferase domain . This atypical mitochondrial targeting sequence is retained in the mature protein. Electron microscopy of immunogold-labeled human FAM173B has shown predominant localization to the cristae of mitochondria, and this localization pattern is likely conserved in the Xenopus ortholog .

What expression systems are optimal for producing functional recombinant Xenopus laevis FAM173B protein?

Recombinant Xenopus laevis FAM173B is typically expressed in E. coli systems with an N-terminal His tag to facilitate purification . To maximize functional protein yield:

  • Expression conditions: Expression in E. coli should be optimized at lower temperatures (16-18°C) to enhance proper folding of the protein.

  • Protein purification: After cell lysis, purification via Ni-NTA affinity chromatography followed by size exclusion chromatography yields the highest purity.

  • Storage considerations: The purified protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. For long-term storage, adding glycerol to a final concentration of 50% and aliquoting for storage at -20°C/-80°C is recommended to prevent protein degradation from repeated freeze-thaw cycles .

  • Reconstitution protocol: For optimal activity, reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can methyltransferase activity of Xenopus laevis FAM173B be assessed in vitro?

To assess the methyltransferase activity of recombinant Xenopus laevis FAM173B:

  • Radiometric assay: Incubate purified recombinant FAM173B with [³H]-S-adenosyl-L-methionine (³H-SAM) as methyl donor and appropriate substrate (e.g., poly-L-lysine for general activity assessment or purified ATP synthase c-subunit for specific activity) .

  • Detection methods:

    • For radiometric assays, detect incorporated ³H-methyl groups by fluorography

    • Alternatively, use antibodies specific to methylated lysine residues for western blot analysis

    • Mass spectrometry can be used to precisely identify methylation sites and quantify methylation levels

  • Controls: Include a catalytically inactive mutant (equivalent to the human D94A mutation in the SAM-binding motif) as a negative control .

  • Substrate specificity: Test activity on both poly-L-lysine and poly-L-arginine homopolymers to confirm lysine-specific methyltransferase activity, as FAM173B shows significant methyltransferase activity on poly-L-lysine but not on poly-L-arginine .

How does Xenopus laevis FAM173B compare structurally and functionally to its human and mouse orthologs?

Phylogenetic analysis reveals that vertebrate FAM173B proteins form a distinct cluster separate from their FAM173A paralogs . Comparison between species shows:

FeatureXenopus laevis FAM173BHuman FAM173BMouse FAM173B
Length226 amino acids~230 amino acids~230 amino acids
Mitochondrial targetingContains N-terminal TMDContains N-terminal TMDContains N-terminal TMD
Primary substrateATP synthase c-subunitATP synthase c-subunitATP synthase c-subunit
Target residueLys-43 of ATPSc (predicted)Lys-43 of ATPScLys-43 of ATPSc
Functional consequenceAffects ATP synthase complex assembly (predicted)Affects ATP synthase complex assembly and ATP productionAffects ATP synthase complex assembly and ATP production

Xenopus laevis FAM173B is likely capable of methylating human ATPSc, similar to how the C. elegans FAM173-like protein (Y39A1A.21) can restore trimethylation of ATPSc at Lys-43 in human FAM173B knockout cells . This functional conservation suggests that the catalytic mechanism and substrate recognition are highly conserved throughout evolution.

What evolutionary insights can be gained from studying non-mammalian FAM173B orthologs like Xenopus laevis FAM173B?

Studying Xenopus laevis FAM173B provides several evolutionary insights:

  • Ancestral function: FAM173B represents one of the closest eukaryotic homologs of a broad-specificity lysine methyltransferase found in some archaea (denoted aKMT) . Comparing Xenopus FAM173B with these ancestral proteins can reveal how methyltransferase specificity evolved.

  • Evolutionary diversification: Phylogenetic analysis shows that vertebrate FAM173B proteins cluster separately from FAM173A paralogs, with non-vertebrate FAM173-like proteins positioned closer to FAM173B than to FAM173A . This suggests that non-vertebrate FAM173-like proteins may represent functional orthologs of vertebrate FAM173B.

  • Conservation of critical residues: Analysis of sequence conservation across species can identify critical residues for catalysis and substrate recognition. Mutations in these conserved regions (like the D94A mutation in the SAM-binding motif) abolish methyltransferase activity .

  • Structural adaptations: Comparing the N-terminal targeting sequences across species reveals how mitochondrial import mechanisms evolved while maintaining precise subcellular localization to the mitochondrial cristae.

How can Xenopus laevis FAM173B be used to study mitochondrial dysfunction in disease models?

Xenopus laevis FAM173B offers several advantages for studying mitochondrial dysfunction:

  • Complementation studies: Recombinant Xenopus FAM173B can be used in complementation assays with mammalian FAM173B knockout cells to assess functional conservation and identify species-specific differences in mitochondrial function regulation.

  • Mitochondrial membrane potential: FAM173B influences mitochondrial membrane potential (ΔΨm), with its expression promoting mitochondrial hyperpolarization . Researchers can study how different domains of Xenopus FAM173B contribute to this effect by creating chimeric proteins or targeted mutations.

  • ATP production analysis: Since FAM173B methylates ATP synthase c-subunit and affects ATP synthase complex assembly, Xenopus FAM173B can be used to study the evolutionary conservation of this regulatory mechanism in mitochondrial energy production .

  • ROS production pathways: In pain models, FAM173B methyltransferase activity in sensory neurons promotes macrophage/microglia activation through a reactive oxygen species (ROS)-dependent pathway . Xenopus FAM173B can be used to determine if this pathway is conserved across vertebrates.

What methodological approaches can resolve contradictory findings about FAM173B expression patterns in different tissues?

Research has shown variable expression patterns of FAM173B across different tissues, including contradictory findings in some disease states like osteoarthritis, where FAM173B expression was reduced in synovial membrane but elevated in subchondral bone compared to controls . To resolve such contradictions:

  • Cell-type specific analysis: Use single-cell RNA sequencing to determine cell-type specific expression patterns within heterogeneous tissue samples.

  • Protein vs. mRNA levels: Compare protein expression (via western blot) with mRNA levels (via qPCR) to identify post-transcriptional regulation.

  • Subcellular fractionation: Isolate mitochondria from different tissues and analyze FAM173B levels to determine if changes reflect altered mitochondrial content rather than expression changes.

  • Tissue-specific regulatory elements: Analyze the promoter and enhancer regions of FAM173B to identify tissue-specific regulatory elements that might explain differential expression.

  • Disease state correlation: Correlate FAM173B expression levels with markers of inflammation, mitochondrial dysfunction, and tissue-specific damage to understand the context-dependent regulation.

How does FAM173B methyltransferase activity contribute to chronic pain mechanisms based on evolutionary conservation?

FAM173B has been implicated in chronic pain through several conserved mechanisms:

  • Mitochondrial function modulation: FAM173B methyltransferase activity promotes mitochondrial hyperpolarization in sensory neurons, which can alter neuronal excitability . This mechanism appears to be dependent on its enzymatic activity, as catalytically inactive mutants fail to produce the same effect.

  • ROS-dependent signaling: FAM173B methyltransferase activity in sensory neurons promotes macrophage/microglia activation through a reactive oxygen species (ROS)-dependent pathway . This immune cell activation contributes to chronic inflammatory states associated with persistent pain.

  • Genome association: Genetic variations in the human FAM173B gene region have been linked to chronic widespread pain in humans, with certain SNPs associated with a 30% higher risk of developing chronic pain . The conservation of FAM173B function across species suggests this pain-promoting role may be evolutionarily conserved.

  • Tissue-specific effects: In osteoarthritis patients, FAM173B expression in synovial membrane correlates with increased pressure pain sensitivity , supporting its role in regulating pain perception.

The evolutionary conservation of these mechanisms suggests that Xenopus laevis FAM173B may share these fundamental roles in pain processing, making it a valuable model for studying pain mechanisms across vertebrate species.

What experimental approaches can determine if Xenopus laevis FAM173B has additional methylation targets beyond ATP synthase c-subunit?

To identify additional methylation targets of Xenopus laevis FAM173B:

  • Proteome-wide methylation profiling:

    • Perform in vitro methylation assays using recombinant Xenopus FAM173B with [³H]-SAM and total mitochondrial extracts

    • Analyze methylated proteins by mass spectrometry to identify modified lysine residues

    • Compare methylation patterns between wild-type and FAM173B knockout/knockdown conditions

  • Candidate approach:

    • Based on known FAM173B preferences for specific sequence contexts around methylation sites (like Lys-43 in ATPSc), identify proteins with similar motifs

    • Test these candidates individually in in vitro methylation assays

  • Crosslinking studies:

    • Use chemical crosslinking followed by mass spectrometry to identify proteins that physically interact with FAM173B in mitochondria

    • These interaction partners represent potential methylation targets

  • Comparative analysis:

    • Compare methylomes of mitochondrial proteins from wild-type and FAM173B-deficient Xenopus models

    • Differences in methylation patterns would indicate direct or indirect targets of FAM173B

Research has shown that human FAM173B can methylate high-molecular-weight proteins beyond just ATPSc , suggesting additional targets likely exist in other species as well, including Xenopus laevis.

What are the critical quality control parameters to ensure functional activity of recombinant Xenopus laevis FAM173B?

Ensuring functional activity of recombinant Xenopus laevis FAM173B requires rigorous quality control:

  • Purity assessment:

    • SDS-PAGE analysis should confirm >90% purity

    • Mass spectrometry can verify protein identity and detect potential modifications

  • Structural integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Size exclusion chromatography to confirm proper oligomeric state (typically monomeric)

  • Enzymatic activity:

    • Methyltransferase activity assay using [³H]-SAM and poly-L-lysine as substrate

    • Activity should be comparable to positive control (human or mouse FAM173B)

    • A catalytically dead mutant (equivalent to human D94A) should serve as negative control

  • Cofactor binding:

    • Thermal shift assays in the presence and absence of S-adenosylmethionine to confirm proper cofactor binding

    • Isothermal titration calorimetry to determine binding affinity for SAM

  • Storage stability:

    • Activity should be tested after different storage conditions (temperature, buffer, freeze-thaw cycles)

    • The protein should retain >80% activity after recommended storage conditions

  • Batch-to-batch consistency:

    • Standardized activity assays should be performed on each batch to ensure consistency

    • Specific activity (nmol methyl groups transferred per minute per mg protein) should be calculated

How can researchers effectively use Xenopus laevis FAM173B as a tool to study mitochondrial dysfunction in metabolic diseases?

Xenopus laevis FAM173B can serve as a valuable tool for studying mitochondrial dysfunction in metabolic diseases through these approaches:

  • Complementation studies in disease models:

    • Express Xenopus FAM173B in human or mouse cells with FAM173B mutations associated with metabolic dysfunction

    • Assess if cross-species expression can rescue phenotypes related to ATP production and mitochondrial function

  • Structure-function relationship:

    • Create chimeric proteins combining domains from Xenopus and mammalian FAM173B

    • Identify which domains are critical for species-specific effects on mitochondrial function

  • Metabolic flux analysis:

    • Compare oxygen consumption rates and extracellular acidification rates in cells expressing wild-type versus mutant Xenopus FAM173B

    • Determine how FAM173B affects different metabolic pathways (glycolysis vs. oxidative phosphorylation)

  • ATP synthase complex assembly:

    • Use blue native PAGE to visualize ATP synthase complex assembly in the presence of wild-type or mutant Xenopus FAM173B

    • Determine if Xenopus FAM173B can restore proper complex assembly in mammalian FAM173B knockout cells

  • ROS production and signaling:

    • Measure mitochondrial ROS production using specific fluorescent probes in cells expressing Xenopus FAM173B

    • Determine how FAM173B-dependent ROS production affects cellular signaling pathways implicated in metabolic diseases

  • Mitochondrial membrane potential:

    • Use TMRM or JC-1 dyes to measure mitochondrial membrane potential in cells expressing wild-type versus mutant Xenopus FAM173B

    • Correlate membrane potential changes with metabolic outcomes

By applying these approaches, researchers can leverage the evolutionary conservation and divergence of FAM173B function to gain insights into fundamental mechanisms of mitochondrial dysfunction in metabolic diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.