Recombinant Xenopus laevis Protein FAM210A (fam210a)

Shipped with Ice Packs
In Stock

Description

Background on Xenopus laevis

Xenopus laevis, commonly known as the African clawed frog, is a widely used model organism in biological research due to its unique developmental characteristics and genetic tractability . Its embryos are particularly valuable for studying developmental biology, genetics, and chemical biology . Xenopus tadpoles have been used to identify compounds affecting blood vascular and lymphatic development, making them useful in pharmacological studies .

FAM210A Function in Cardiac Health

Recent studies have highlighted the importance of FAM210A in maintaining cardiac health. Decreased expression of FAM210A has been observed in human ischemic heart failure and mouse myocardial infarction tissue samples, indicating its potential role in heart disease . In mouse cardiomyocytes, conditional knockout of Fam210a led to progressive dilated cardiomyopathy and heart failure, ultimately causing mortality .

Key observations include:

  • Severe mitochondrial morphological disruption and functional decline

  • Increased mitochondrial reactive oxygen species production

  • Disturbed mitochondrial membrane potential

  • Reduced respiratory activity

  • Disrupted proteostasis due to compromised mitochondrial mRNA translation

Multi-omics analyses have further revealed that FAM210A deficiency activates integrated stress response (ISR), leading to transcriptomic, translatomic, proteomic, and metabolomic reprogramming, which contributes to the pathogenic progression of heart failure . Conversely, AAV9-mediated overexpression of FAM210A has been shown to promote mitochondrial-encoded protein expression, improve cardiac mitochondrial function, and partially rescue murine hearts from cardiac remodeling and damage in ischemia-induced heart failure .

FAM210A's Role in Muscle Maintenance

FAM210A is also critical for muscle maintenance and metabolic functions. Studies in mice have demonstrated that the deletion of Fam210a in myocytes causes progressive myopathy and severe muscle weakness, leading to systemic metabolic defects and premature death . Loss of Fam210a results in disruption of mitochondrial cristae structure and diminished mitochondrial abundance in myofibers, accompanied by a deficiency in mitochondrial energy metabolism . Proteomics analysis indicates an induction of mitochondrial proteostatic response and apoptosis in Fam210a-null myofibers, concurrent with a reduction of the mitochondrial translation program .

Molecular Mechanisms of FAM210A

FAM210A functions as a mitochondrial translation regulator. It interacts with the mitochondrial translation machinery to ensure efficient and accurate synthesis of mitochondrial-encoded proteins . This is vital for maintaining mitochondrial homeostasis and normal cellular function. Metabolomic analysis has revealed that loss of FAM210A leads to an abnormal flow of the TCA cycle and accumulation of acetyl-CoA, resulting in hyperacetylation of ribosomal proteins and stagnant translation .

FAM210A and Cold-Induced Mitochondrial Remodeling

FAM210A is essential for cold-induced mitochondrial remodeling in brown adipose tissue. It interacts with the mitochondrial translation machinery .

Chemical Library Screening with Xenopus

Xenopus embryos are utilized in chemical library screens to identify compounds with pharmacologic activity. These screens help uncover pathways involved in vascular development . A two-step screening strategy involving phenotypic read-outs, such as edema formation or larval lethality, followed by semi-automated in situ hybridization, is used to screen bioactive compounds . For example, a screen of 1280 bioactive compounds identified 32 active compounds that interfere with blood vascular and/or lymphatic development in Xenopus .

Table 1: Effects of FAM210A Deficiency in Mouse Cardiomyocytes

ObservationResult
Mitochondrial MorphologySevere disruption
Mitochondrial FunctionDecline
Reactive Oxygen Species (ROS) ProductionIncreased
Mitochondrial Membrane PotentialDisturbed
Respiratory ActivityReduced
Integrated Stress Response (ISR)Activated
Transcriptomic, Translatomic, Proteomic,Reprogramming
Metabolomic ProfilesAltered
Mitochondrial mRNA TranslationCompromised
Mitochondrial-Encoded ProteinsReduced

Table 2: Effects of FAM210A Loss in Mouse Myocytes

ObservationResult
Mitochondrial Cristae StructureDisrupted
Mitochondrial AbundanceDiminished
Mitochondrial Energy MetabolismDeficiency
Proteostatic ResponseInduction of mitochondrial proteostatic response and apoptosis
Mitochondrial TranslationReduction of the mitochondrial translation program
TCA CycleAbnormal flow
Acetyl-CoAAccumulation
Ribosomal ProteinsHyperacetylation, contributing to stagnant translation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fam210a; Protein FAM210A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
fam210a
Target Protein Sequence
MHLLRTLLLRSNTSNISLLTKCSFRASPLHKWPISLRSGSQISLLPTEQKKWLHSQPKQQ DTATKTPVHDLPSGIQHQSEETSPSARSSISTDPSSIAEEDPLQDQSIGLLKRFKKTFRQ HGKVLIPVHLVTSSIWFGSFYYAAMQGVNVVPFLEYIGLPDGIVNILKNSQGGNALTAYA MYKIATPARYTVTLGGTSVSVKYLRKYGYLSTPPLVKDYFQDRMEETKELFTEKMEETRD IISGKMEETKDRISEKLQETKDRVAFRKKKNEDME
Uniprot No.

Target Background

Function
Plays a potential role in the structural integrity and strength of both muscle and bone tissue.
Database Links

KEGG: xla:496228

UniGene: Xl.53434

Protein Families
FAM210 family
Subcellular Location
Membrane; Single-pass membrane protein. Mitochondrion. Cytoplasm.

Q&A

What is FAM210A and what is its biological significance in Xenopus laevis?

FAM210A (Family with sequence similarity 210 member A) is a protein that plays critical roles in mitochondrial function. In Xenopus laevis, the full-length protein consists of 275 amino acids (Q5M7E0) and is primarily involved in regulating mitochondrial protein synthesis . While FAM210A has been more extensively studied in mammals, research using the Xenopus model provides valuable insights into its evolutionary conservation and fundamental functions.

FAM210A is a mitochondrial inner membrane protein that regulates the protein synthesis of mitochondrial DNA-encoded genes . Its expression pattern in Xenopus follows tissue-specific distribution similar to mammals, with strong expression in muscle tissues and lower expression in other tissues .

What are the key properties and sequence characteristics of Xenopus laevis FAM210A?

The Xenopus laevis FAM210A protein has the following key characteristics:

PropertyDescription
UniProt IDQ5M7E0
Length275 amino acids (full length)
Synonymsfam210a; Protein FAM210A
Amino Acid SequenceMHLLRTLLLRSNTSNISLLTKCSFRASPLHKWPISLRSGSQISLLPTEQKKWLHSQPKQQDTATKTPVHDLPSGIQHQSEETSPSARSSISTDPSSIAEEDPLQDQSIGLLKRFKKTFRQHGKVLIPVHLVTSSIWFGSFYYAAMQGVNVVPFLEYIGLPDGIVNILKNSQGGNALTAYAMYKIATPARYTVTLGGTSVSVKYLRKYGYLSTPPLVKDYFQDRMEETKELFTEKMEETRDIISGKMEETKDRISEKLQETKDRVAFRKKKNEDME
Predicted LocalizationMitochondrial inner membrane

The protein contains transmembrane domains consistent with its localization to the mitochondrial inner membrane . Sequence analysis shows conserved regions that are likely important for its function in mitochondrial translation regulation.

How is recombinant Xenopus laevis FAM210A typically expressed and purified?

Recombinant Xenopus laevis FAM210A can be expressed using bacterial expression systems, typically E. coli. The recommended approach includes:

  • Expression System: Full-length Xenopus laevis FAM210A protein is commonly expressed in E. coli using a vector that incorporates an N-terminal His-tag for purification purposes .

  • Purification Method: The protein is typically purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin due to its His-tag .

  • Storage Recommendations:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Working aliquots can be stored at 4°C for up to one week

How does Xenopus laevis serve as a model for studying FAM210A function?

Xenopus laevis offers several advantages as a model organism for studying FAM210A function:

  • Evolutionary Conservation: FAM210A is well-conserved among vertebrates, making Xenopus studies relevant to understanding its function in humans .

  • Experimental Tractability: Xenopus embryos are large, abundant, and easily manipulated, allowing for various experimental approaches including microinjection of mRNAs or morpholinos to study gain or loss of function .

  • Genomic Resources: Although Xenopus laevis has an allotetraploid genome, modern genomic approaches have overcome this challenge. Full-length cDNA libraries and the Xenopus ORFeome project provide valuable resources for studying genes like FAM210A .

  • Complementary Model: Research can leverage both Xenopus laevis and Xenopus tropicalis, with the latter offering advantages for genetic studies due to its diploid genome and shorter generation time .

What methodologies are effective for studying FAM210A's role in mitochondrial translation in Xenopus systems?

For investigating FAM210A's role in mitochondrial translation in Xenopus systems, researchers can employ several methodologies:

  • Mitochondrial Polysome Profiling: This technique can capture mitochondrial monosomes complexed with their ribosome-protected footprints (RPF) upon RNase I digestion. Analysis of RPF density can reveal changes in translational efficiency of mitochondrial-encoded genes when FAM210A function is altered .

  • Mitochondrial Ribosome Association Assays: Pulldown assays can be used to validate interactions between purified FAM210A and mitochondrial translation machinery components, such as mitochondrial elongation factors (e.g., EF-Tu) .

  • Multi-omics Approach: Combining transcriptomics, proteomics, and metabolomics provides comprehensive insights into how FAM210A affects mitochondrial function. This approach has been successfully used in mammalian models and can be adapted for Xenopus studies .

  • Mitochondrial Functional Assays: Measuring reactive oxygen species production, membrane potential, and respiratory activity in isolated mitochondria from FAM210A-manipulated Xenopus tissues can reveal functional consequences of altered FAM210A expression .

How can recombinant Xenopus laevis FAM210A be used in protein-protein interaction studies?

To investigate protein-protein interactions involving FAM210A:

  • Pulldown Assays: Using His-tagged recombinant Xenopus FAM210A as bait with Xenopus tissue lysates can identify natural binding partners. This approach has successfully demonstrated FAM210A's interaction with mitochondrial elongation factor EF-Tu in human cells and can be adapted for Xenopus studies .

  • Protein Complex Reconstitution: Purified recombinant FAM210A can be used to reconstitute complexes with potential interacting partners in vitro to study direct interactions and complex formation dynamics.

  • Proximity Labeling: Adapting techniques like BioID or APEX2 for use with FAM210A in Xenopus cells can identify proximal proteins in the native mitochondrial environment.

  • Yeast Two-Hybrid Screening: Modified for membrane proteins, this approach can be used with Xenopus FAM210A to screen for interacting partners from a Xenopus cDNA library.

Recommended buffer conditions for interaction studies:

  • Tris/PBS-based buffer, pH 8.0

  • Consider including 6% Trehalose to maintain protein stability

  • Add detergents at low concentrations when working with this membrane protein

  • Include protease inhibitors to prevent degradation during incubation periods

What are the challenges in expressing and working with recombinant Xenopus laevis FAM210A and how can they be addressed?

Key challenges and solutions include:

  • Membrane Protein Solubility:

    • Challenge: As a mitochondrial inner membrane protein, FAM210A has hydrophobic regions that can cause aggregation.

    • Solution: Express as a fusion protein with solubility tags like MBP or SUMO. The MBP-His₁₀ fusion approach has been successful for human FAM210A and can be adapted for the Xenopus protein .

  • Proper Folding:

    • Challenge: Ensuring correct folding of recombinant FAM210A in bacterial systems.

    • Solution: Express at lower temperatures (16-18°C) and use specialized E. coli strains designed for membrane proteins. Consider using chaperone co-expression systems.

  • Functional Validation:

    • Challenge: Confirming that recombinant protein retains native function.

    • Solution: Develop functional assays based on FAM210A's role in mitochondrial translation, such as in vitro translation assays with isolated mitochondrial ribosomes.

  • Storage Stability:

    • Challenge: Maintaining protein stability during storage.

    • Solution: As recommended for the commercial product, use 6% Trehalose in the storage buffer and store with glycerol at -80°C. Avoid repeated freeze-thaw cycles .

How can researchers use loss-of-function and gain-of-function approaches to study FAM210A in Xenopus?

For comprehensive functional analysis of FAM210A in Xenopus:

Loss-of-Function Approaches:

  • Morpholino Oligonucleotides: Design antisense morpholinos targeting the translation start site or splice junctions of Xenopus FAM210A mRNA. Inject into embryos at early stages to knock down expression.

  • CRISPR/Cas9 Genome Editing: Design sgRNAs targeting the FAM210A gene in Xenopus tropicalis (which has a diploid genome) to generate knockout models. This approach has been successful for other genes in Xenopus .

  • Dominant Negative Constructs: Design truncated versions of FAM210A that can interfere with the function of the endogenous protein when overexpressed.

Gain-of-Function Approaches:

  • mRNA Microinjection: Synthesize capped mRNA encoding full-length FAM210A and inject into embryos for overexpression studies, a classical approach in Xenopus .

  • Transgenic Expression: Develop transgenic Xenopus lines with tissue-specific or inducible expression of FAM210A using established transgenic methods .

  • AAV-Mediated Expression: Adapt AAV9-mediated expression systems, which have successfully been used to overexpress FAM210A in mammalian models , for use in Xenopus.

What evidence exists for FAM210A's role in cross-talk between mitochondria and other cellular components in Xenopus compared to mammals?

While direct evidence in Xenopus is limited, mammalian studies provide insight into potential cross-talk mechanisms that could be investigated in Xenopus:

  • Mitochondria-Ribosome Cross-talk: In mammals, FAM210A mediates communication between mitochondria and cytosolic ribosomes. FAM210A knockout in mice leads to:

    • Reversal of the oxidative TCA cycle toward the reductive direction

    • Acetyl-CoA accumulation causing hyperacetylation of cytosolic proteins

    • Hyperacetylation of ribosomal proteins leading to ribosome disassembly and translational defects

  • Mitochondria-Muscle-Bone Axis: Though FAM210A is not expressed in bone, its expression in muscle affects bone structure:

    • Genetic variation near FAM210A is associated with both lean mass and bone mineral density in humans

    • In mice, global heterozygous knockout of Fam210a reduces both muscle strength and bone density

  • Mitochondria-Heart Function: FAM210A regulates mitochondrial translation in cardiomyocytes:

    • Cardiomyocyte-specific knockout leads to dilated cardiomyopathy and heart failure

    • FAM210A deficiency activates integrated stress response (ISR) in heart tissue

These mechanisms could be investigated in Xenopus using a combination of biochemical, genetic, and imaging approaches to determine if similar cross-talk mechanisms are conserved.

How can comparative studies between Xenopus laevis FAM210A and mammalian orthologs provide insights into its evolutionary conservation and function?

Comparative studies can provide valuable insights through several approaches:

  • Sequence and Structure Analysis:

    • Alignment of Xenopus laevis FAM210A (275aa) with human and mouse orthologs to identify conserved domains and motifs

    • Homology modeling based on available structural data to predict functional domains

    • Analysis of conservation at key residues that may be involved in protein-protein interactions

  • Functional Complementation:

    • Express Xenopus FAM210A in mammalian FAM210A-knockout cells to assess functional rescue

    • Conversely, express mammalian FAM210A in Xenopus embryos with FAM210A knockdown to test cross-species functionality

  • Comparative Protein Interaction Profiles:

    • Identify protein interaction partners of FAM210A in both Xenopus and mammalian systems

    • Compare interactomes to identify conserved core interactions versus species-specific interactions

  • Evolutionary Rate Analysis:

    • Compare rates of sequence evolution in different domains of FAM210A across species

    • Identify regions under purifying selection (highly conserved) versus regions under relaxed selection or positive selection

  • Expression Pattern Comparison:

    • Compare tissue-specific expression patterns of FAM210A between Xenopus and mammals

    • Assess whether regulatory elements controlling expression are conserved

These comparative approaches can reveal which aspects of FAM210A function are ancient and conserved versus those that may have evolved new functions in different vertebrate lineages.

How can Xenopus laevis FAM210A research contribute to understanding mitochondrial diseases?

FAM210A research in Xenopus can contribute to mitochondrial disease understanding in several ways:

  • Model System Advantages: Xenopus offers unique advantages for studying early developmental effects of mitochondrial dysfunction:

    • Large embryos allow biochemical analyses that require substantial material

    • Transparent embryos enable real-time visualization of mitochondrial dynamics

    • External development permits study of severe phenotypes that might be embryonic lethal in mammals

  • Conservation of Mitochondrial Pathways: Fundamental mitochondrial translation mechanisms are conserved between amphibians and mammals, making Xenopus findings potentially translatable to human mitochondrial diseases.

  • Specific Research Applications:

    • Using Xenopus oocytes and embryos to study how FAM210A mutations affect mitochondrial translation efficiency

    • Investigating tissue-specific consequences of FAM210A dysfunction in developing Xenopus tadpoles

    • Screening for small molecules that restore mitochondrial function in FAM210A-deficient Xenopus models

  • Therapeutic Insights: Research from mouse models indicates that AAV9-mediated FAM210A overexpression can improve mitochondrial function in disease states . Similar approaches could be tested in Xenopus to validate conservation of therapeutic mechanisms.

What are the most promising techniques for investigating FAM210A subcellular localization and dynamics in Xenopus cells?

For investigating FAM210A's subcellular localization and dynamics in Xenopus cells, researchers should consider:

  • Immunofluorescence Microscopy:

    • Stain Xenopus cells with anti-FAM210A antibody together with mitochondrial markers (e.g., ATPB)

    • Use confocal microscopy to visualize co-localization, as successfully done in mouse studies

    • Recommended protocol: Fix cells in 4% paraformaldehyde for 10 minutes, block with 1% BSA for 1 hour, incubate with primary antibodies (anti-FAM210A 1:200, anti-ATPB 1:200) overnight at 4°C, followed by fluorescent secondary antibodies (e.g., Alexa Fluor 488, 568 at 1:200 dilution)

  • Live Cell Imaging:

    • Generate fluorescent protein fusions (e.g., FAM210A-GFP) for expression in Xenopus cells

    • Use time-lapse microscopy to track dynamics in real-time

    • Combine with mitochondrial dyes (e.g., MitoTracker) to confirm localization

  • Super-Resolution Microscopy:

    • Techniques like STED or STORM can provide nanometer-scale resolution of FAM210A localization within mitochondrial subcompartments

    • This can reveal precise positioning relative to the mitochondrial translation machinery

  • Proximity Labeling:

    • Fusion of FAM210A with proximity labeling enzymes (BioID or APEX2)

    • Expression in Xenopus cells to identify proteins in close proximity

    • This approach can map the spatial environment of FAM210A in the mitochondrial inner membrane

  • Electron Microscopy:

    • Immunogold labeling of FAM210A combined with electron microscopy

    • Can precisely localize FAM210A within mitochondrial substructures (e.g., cristae, inner boundary membrane)

What experimental designs could help resolve contradictory findings about FAM210A function across different species and tissues?

To address potential contradictions in FAM210A research across species and tissues:

  • Standardized Multi-Species Comparison:

    • Design experiments that simultaneously analyze FAM210A function in multiple species (e.g., Xenopus, zebrafish, mouse) using identical methodologies

    • Include tissue-specific analyses within each species to identify both conserved and divergent functions

  • Conditional Knockout/Knockdown Systems:

    • Develop tissue-specific and temporally controlled FAM210A manipulation in Xenopus

    • Compare with similar approaches in other model organisms

    • This can help distinguish primary effects from secondary adaptations or compensatory mechanisms

  • Rescue Experiments Across Species:

    • Test whether FAM210A from one species can rescue phenotypes in another species

    • For example, can human FAM210A rescue defects in Xenopus FAM210A knockdown models?

    • This approach can identify functionally conserved domains versus species-specific elements

  • Domain Swap Experiments:

    • Create chimeric proteins containing domains from FAM210A of different species

    • Test functionality in various assays to identify which domains confer species-specific functions

  • Comprehensive Omics Approach:

    • Apply identical multi-omics analyses (transcriptomics, proteomics, metabolomics) across species and tissues

    • This can reveal conserved versus divergent molecular pathways affected by FAM210A

  • Systematic Interaction Mapping:

    • Identify protein-protein interactions of FAM210A in different species and tissues

    • Compare interactomes to identify context-specific binding partners that might explain functional differences

How can structural analysis of Xenopus laevis FAM210A contribute to understanding its molecular mechanism?

Structural analysis can provide crucial insights through:

  • X-ray Crystallography or Cryo-EM:

    • Purified recombinant Xenopus FAM210A can be subjected to crystallization trials

    • For membrane proteins like FAM210A, detergent selection is critical (consider testing multiple detergents including DDM, LMNG, and GDN)

    • Alternatively, cryo-electron microscopy may be suitable for this transmembrane protein

    • Structural data can reveal binding pockets and interaction surfaces

  • Structure-Function Analysis:

    • Based on structural information, design site-directed mutagenesis of key residues

    • Test mutant versions in functional assays to correlate structure with function

    • Focus on putative interaction sites with the mitochondrial translation machinery

  • Computational Approaches:

    • In the absence of experimental structures, homology modeling can predict structural features

    • Molecular dynamics simulations can suggest conformational changes relevant to function

    • Docking studies with known interaction partners can predict binding interfaces

  • NMR Studies of Domains:

    • While full-length membrane proteins are challenging for NMR, soluble domains can be analyzed

    • This can provide information about dynamic regions and conformational changes

  • Comparative Structural Biology:

    • Compare predicted or determined structures across species

    • Identify conserved structural elements that likely mediate core functions

The successful purification method developed for human FAM210A using MBP-His₁₀ fusion and a two-step purification process provides a foundation for similar structural work with the Xenopus protein.

How can researchers address issues with recombinant Xenopus laevis FAM210A stability and activity?

For optimal stability and activity:

  • Expression Optimization:

    • Test multiple fusion tags (His, MBP, GST, SUMO) to identify optimal solubility and stability

    • Optimize expression temperature (typically lower temperatures of 16-18°C improve folding)

    • Consider codon optimization for E. coli expression

  • Buffer Optimization:

    • Test various buffer compositions; start with Tris/PBS-based buffer, pH 8.0 with 6% Trehalose

    • Screen different pH conditions (range 7.0-8.5)

    • Add stabilizing agents such as glycerol (5-50%)

    • Include reducing agents like DTT or β-mercaptoethanol to prevent oxidation of cysteine residues

  • Protein Handling:

    • Minimize freeze-thaw cycles (aliquot before freezing)

    • Centrifuge briefly before opening to bring contents to the bottom

    • Keep at 4°C for short-term work (up to one week)

    • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Activity Validation:

    • Develop functional assays specific to FAM210A's role in mitochondrial translation

    • Confirm proper folding using circular dichroism spectroscopy

    • Verify mitochondrial protein interactions using pulldown assays with known partners

  • Structural Stabilization:

    • Consider using nanodiscs or amphipols for membrane protein stabilization

    • Test detergent screening to identify optimal conditions for maintaining native conformation

What controls and validation steps are essential when studying FAM210A function in Xenopus systems?

Essential controls and validation include:

  • Expression Validation:

    • Confirm FAM210A knockdown or overexpression efficiency using RT-qPCR

    • Validate protein levels by Western blot with specific antibodies

    • Use immunofluorescence to confirm subcellular localization

  • Specificity Controls:

    • Include rescue experiments with wild-type FAM210A to confirm phenotype specificity

    • Use multiple non-overlapping morpholinos or siRNAs targeting different regions of FAM210A

    • Include scrambled or mismatch control morpholinos/siRNAs

  • Functional Validation:

    • Confirm mitochondrial function changes using established assays (membrane potential, respiration, ROS production)

    • Measure mitochondrial translation efficiency using metabolic labeling approaches

    • Assess mitochondrial morphology using electron microscopy or confocal imaging

  • Cross-Species Validation:

    • Compare findings in Xenopus with data from mammalian systems to confirm conservation

    • Consider parallel experiments in both Xenopus laevis and Xenopus tropicalis

  • Developmental Stage Considerations:

    • Control for developmental stage when comparing FAM210A function across conditions

    • Document and account for potential stage-specific effects

  • Technical Controls:

    • Include positive and negative controls for all assays

    • Perform biological replicates using embryos from different parents

    • Consider technical replicates to account for experimental variation

How can researchers design experiments to distinguish between direct and indirect effects of FAM210A manipulation in Xenopus?

To distinguish direct from indirect effects:

  • Temporal Analysis:

    • Perform time-course experiments after FAM210A manipulation

    • Early changes are more likely to represent direct effects, while later changes may be secondary

    • Use inducible systems (e.g., hormone-inducible promoters) to enable precise temporal control

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics at multiple time points

    • Apply network analysis to identify primary nodes affected by FAM210A manipulation

    • Look for enrichment of mitochondrial translation-related pathways, which are likely direct effects

  • Mechanistic Dissection:

    • Create FAM210A mutants with specific domain deletions or point mutations

    • Test which molecular interactions are required for specific phenotypes

    • This can link specific protein functions to observed effects

  • Direct Biochemical Assays:

    • Develop in vitro assays to test direct effects of FAM210A on mitochondrial translation

    • Use isolated mitochondria or reconstituted translation systems

    • Compare results to in vivo phenotypes

  • Rescue Experiments:

    • Perform targeted rescue experiments that address specific pathways

    • For example, if FAM210A loss affects ATP production, test whether ATP supplementation rescues downstream effects

    • This approach can help establish causality in regulatory networks

  • Single-Cell Analysis:

    • Use single-cell approaches to distinguish cell-autonomous effects from non-cell-autonomous effects

    • This is particularly relevant for understanding tissue-specific phenotypes

The combination of these approaches can help construct a hierarchical model of FAM210A's direct effects versus secondary consequences of its manipulation.

What are the most promising areas for future research on FAM210A in Xenopus models?

Key future research directions include:

  • Developmental Regulation:

    • Investigate the temporal and spatial expression patterns of FAM210A during Xenopus development

    • Determine how FAM210A function influences embryonic and larval development

    • Explore potential developmental phenotypes resulting from FAM210A manipulation

  • Tissue Regeneration:

    • Explore FAM210A's role in Xenopus limb and tail regeneration

    • Determine if mitochondrial translation regulation by FAM210A influences regenerative capacity

    • Test whether FAM210A manipulation can enhance regenerative outcomes

  • Evolutionary Comparisons:

    • Compare FAM210A function between Xenopus laevis, Xenopus tropicalis, and other vertebrates

    • Explore how differences in mitochondrial biology across species relate to FAM210A function

    • Investigate whether gene duplication in Xenopus laevis has led to subfunctionalization of FAM210A

  • Mechanistic Dissection:

    • Determine the precise molecular mechanism by which FAM210A regulates mitochondrial translation

    • Identify direct interaction partners and their functional significance

    • Resolve the structure of Xenopus FAM210A and compare with mammalian orthologs

  • Disease Modeling:

    • Use Xenopus to model human diseases associated with FAM210A dysfunction

    • Develop screening platforms to identify compounds that normalize FAM210A function

    • Test therapeutic strategies targeting the FAM210A pathway

How can systems biology approaches enhance our understanding of FAM210A function in Xenopus?

Systems biology approaches offer powerful ways to understand FAM210A:

  • Network Analysis:

    • Construct protein-protein interaction networks centered on FAM210A

    • Integrate multi-omics data to build regulatory networks affected by FAM210A

    • Identify hub proteins and key pathways that interact with FAM210A function

  • Mathematical Modeling:

    • Develop quantitative models of mitochondrial translation incorporating FAM210A

    • Create predictive models of metabolic changes resulting from FAM210A manipulation

    • Use modeling to generate testable hypotheses about system-level effects

  • Comparative Omics:

    • Apply identical multi-omics analyses across different tissues and developmental stages

    • Compare FAM210A-dependent changes across contexts to identify core versus context-specific functions

    • Integrate data from multiple species to identify evolutionarily conserved modules

  • Single-Cell Multi-omics:

    • Apply single-cell transcriptomics and proteomics to FAM210A-manipulated Xenopus embryos

    • Map cell-type-specific responses to FAM210A perturbation

    • Identify cell populations particularly sensitive to FAM210A function

  • Genome-Scale Screens:

    • Perform genetic or chemical screens to identify modifiers of FAM210A function

    • Use CRISPR/Cas9 screens to discover synthetic lethal or synthetic viable interactions

    • Integrate screen results with network models to refine understanding of FAM210A's functional context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.