Recombinant Xenopus laevis Protein FAM73B (fam73b)

Shipped with Ice Packs
In Stock

Description

General Information

FAM73B, also known as Mitoguardin 2 (MIGA2), is a protein involved in mitochondrial fusion . In Xenopus laevis, recombinant FAM73B plays a crucial role in various biological processes, including immune response modulation and vascular development .

Function and Mechanism

FAM73B, located in the outer mitochondrial membrane, impacts Toll-like receptor (TLR) regulated mitochondrial morphology, specifically the switch between fusion and fission . Ablation of Fam73b promotes IL-12 production . In tumor-associated macrophages, this switch enhances anti-tumor immunity by activating T-cells .

Role in Immune Response

Fam73b in macrophages and dendritic cells promotes TLR-induced IL-12 expression while inhibiting IL-10 and IL-23 expression . Studies using a murine melanoma model have demonstrated that Fam73b deletion significantly suppresses tumor growth and increases survival rates in tumor-bearing mice . This deletion also leads to increased levels of IL-12 and IFN-γ in the serum .

Table 1: Impact of FAM73B on Cytokine Expression

CytokineEffect of FAM73B Deficiency
IL-12Increased
IL-10Reduced
IFN-γUpregulated

Mitochondrial Dynamics

FAM73B is a crucial regulator of mitochondrial dynamics during macrophage polarization . It influences mitochondrial morphology and affects Parkin expression and recruitment to mitochondria . Parkin, in turn, controls the stability of the CHIP–IRF1 axis through proteolysis .

Impact on Vascular Development

In Xenopus tadpoles, chemical library screening has identified compounds that interfere with blood vascular and lymphatic development . These compounds can cause edema formation or larval lethality, indicating their importance in vascular and lymphatic function .

Gene Expression Analysis

Transcriptome analysis reveals that FAM73B deficiency leads to differential expression of genes involved in cell survival and development . Specifically, Fam73b ablation enhances Il12a induction and suppresses Il10 and Arg1 when responding to TLR stimulation .

Implications for Tumor Development

FAM73B KO mice exhibit a lower rate of fibrosarcoma development, accompanied by increased IL-12 and IFN-γ serum levels . This suggests that FAM73B plays a significant role in tumor development by modulating the immune response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
miga2; fam73b; Mitoguardin 2; Protein FAM73B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
miga2
Target Protein Sequence
MAFQRAEGMSIIQALAMTVAEIPVFLYTTFGQSTFSQLRLSPGLRKVLFATALGTVALAL AAHQLKRRKHKKKQITADNGGLKLGGVPGSVLPVRRSSSAKKGYSRSRVQSPSSKSNDTL SGISSLDPSKHSSSSHSLASVVAVNSSSINAAPAGPWESPEMDETLEEGDSNAENLYIQG MELFEEALHKWEQALNVGQRCRSNTPASQVNDLLNQSCSEGLSEDSQSGHFAGKLEALLY RAYNLQEEFGTSIPPDDLLMDLEGSLIFPLVESRRALMMDDEGSSTSEDSFFSAAELFET LQLNEVPFLPTKPAAAYEEALKLVHTGEVACRTLRTELLGCYNDQDFLAKLHCVRQAFEV LLLDDGNQLFFGEVGKQMITGLMQKAEKNPKGFLENYEEMLRYALKQDTWATTQRELKGR GVVCMNFFDIALDFILMDAFEDLESPPSSVLAVLRNRWLSDSFKETALATACWSVLKAKR RLLMVPDGFISHFYSVSEHVSPVLAYGFLGPKEHLTEVCNFFKNQIVQYLKDMFDLDNVR YSTIQSLAEDILHLSRRRSDILLGYLGVETVREMNGAVPVQTTEAELDL
Uniprot No.

Target Background

Function

Function: FAM73B is a regulator of mitochondrial fusion. It functions by forming homo- and heterodimers at the mitochondrial outer membrane, facilitating the formation of pld6/MitoPLD dimers. Its mechanism of action may involve the regulation of phospholipid metabolism via pld6/MitoPLD.

Database Links

KEGG: xla:443773

UniGene: Xl.47486

Protein Families
Mitoguardin family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is the basic structural characterization of FAM73B in Xenopus laevis?

FAM73B (also known as MIGA2) in Xenopus laevis is a mitochondrial outer membrane protein involved in the regulation of mitochondrial dynamics. The recombinant full-length protein consists of 226 amino acids (1-226aa) and is typically expressed with an N-terminal His tag for purification purposes. The protein is available in lyophilized powder form with greater than 90% purity as determined by SDS-PAGE analysis . The amino acid sequence reveals structural motifs consistent with its function as a membrane-associated protein that participates in protein-protein interactions involved in mitochondrial fusion and fission processes .

How does FAM73B function in mitochondrial dynamics?

FAM73B functions as a pivotal regulator in Toll-like receptor (TLR)-regulated mitochondrial morphology, specifically controlling the switch from fusion to fission states in mitochondria. Research has demonstrated that FAM73B (MIGA2) plays a crucial role in maintaining normal mitochondrial fusion. When FAM73B is ablated (Fam73b knockout), cells show increased mitochondrial fission, which consequently promotes IL-12 production in immune cells . This molecular switch mechanism has significant implications for cellular metabolism and immune function, particularly in the context of innate immunity and anti-tumor responses. The protein's localization to the mitochondrial outer membrane positions it as a key mediator between external cellular signals and mitochondrial structural responses .

What are the recommended storage and handling protocols for recombinant Xenopus laevis FAM73B protein?

For optimal stability and activity of recombinant Xenopus laevis FAM73B protein, follow these evidence-based handling protocols:

  • Initial Storage: Store the lyophilized protein at -20°C/-80°C upon receipt.

  • Reconstitution Process:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is the standard recommendation)

  • Working Storage: Prepare multiple aliquots to avoid repeated freeze-thaw cycles

  • Short-term Use: Working aliquots can be stored at 4°C for up to one week

  • Buffer Conditions: The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Repeated freezing and thawing should be strictly avoided as it significantly compromises protein stability and functionality .

How can I design experiments to study FAM73B's role in mitochondrial fusion-fission dynamics in Xenopus model systems?

To investigate FAM73B's role in mitochondrial dynamics using Xenopus as a model system, implement the following experimental approach:

  • Genetic Manipulation Strategies:

    • CRISPR/Cas9-mediated knockout of Fam73b gene

    • Morpholino-based knockdown for transient suppression

    • Targeted overexpression using microinjection of mRNA at specific developmental stages

  • Mitochondrial Morphology Analysis:

    • Live imaging of mitochondria using fluorescent markers (MitoTracker dyes)

    • Transmission electron microscopy (TEM) for ultrastructural analysis

    • Confocal microscopy with immunostaining for mitochondrial markers

  • Functional Assessment:

    • Measurement of mitochondrial membrane potential

    • Analysis of ATP production and metabolic profiles

    • Assessment of reactive oxygen species (ROS) production

  • Downstream Signaling Analysis:

    • Quantification of IL-12 production following TLR stimulation

    • Analysis of Parkin recruitment to mitochondria

    • Evaluation of the CHIP-IRF1 axis activity

Utilize the advantages of Xenopus as a model organism, including its rapid development, cost-effectiveness, and suitability for high-throughput screening to effectively characterize FAM73B's functional role .

What approaches can be used to resolve contradictory data regarding FAM73B's impact on immune responses?

When encountering contradictory data regarding FAM73B's impact on immune responses, implement this systematic troubleshooting approach:

  • Validate Protein Expression and Knockdown Efficiency:

    • Confirm successful knockdown/knockout using multiple methodologies (Western blot, qPCR)

    • Verify specificity of targeting using rescue experiments with wild-type protein

  • Context-Dependent Analysis:

    • Evaluate effects in different cell types (macrophages vs. dendritic cells)

    • Compare responses under various stimulation conditions (different TLR agonists)

    • Assess temporal dynamics of responses (early vs. late immune activation)

  • Comprehensive Immune Profiling:

    • Analyze multiple cytokines beyond IL-12 (TNF-α, IL-6, IFN-γ)

    • Characterize T-cell activation markers (CD69, CD25)

    • Assess functional outputs (phagocytosis, antigen presentation)

  • Isolate Variables:

    • Determine if contradictions arise from mitochondrial vs. non-mitochondrial functions

    • Evaluate potential compensation by related proteins (FAM73A/MIGA1)

    • Control for developmental stage-specific effects in Xenopus model

  • Cross-Validate with Multiple Techniques:

    • Combine in vitro and in vivo approaches

    • Utilize both gain-of-function and loss-of-function strategies

    • Compare results across different model systems (Xenopus, mouse, human cells)

This methodical approach will help disambiguate contradictory results by identifying specific conditions where FAM73B exerts differential effects on immune responses.

How can protein-protein interaction networks of FAM73B be mapped in the context of mitochondrial dynamics?

To comprehensively map protein-protein interaction networks of FAM73B in the context of mitochondrial dynamics, implement this multi-faceted approach:

  • Affinity-Based Protein Interaction Methods:

    • Co-immunoprecipitation (Co-IP) using anti-His tag antibodies for the recombinant protein

    • Pull-down assays with GST-tagged FAM73B as bait

    • BioID or APEX2 proximity labeling to identify proteins in close proximity to FAM73B in mitochondrial membranes

  • Advanced Interaction Mapping Techniques:

    • Crosslinking mass spectrometry (XL-MS) to identify direct binding partners

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • Förster resonance energy transfer (FRET) to visualize interactions in living cells

  • Functional Validation of Interactions:

    • Mutational analysis of key domains in FAM73B to disrupt specific interactions

    • Competition assays to identify binding hierarchies

    • Reconstitution experiments using purified components

  • Computational Network Analysis:

    • Integration of experimental data with existing interaction databases

    • Network modeling to predict functional clusters

    • Molecular dynamics simulations to predict structural interactions

  • Specific Interaction Targets to Investigate:

    • Mitochondrial fusion machinery (Mfn1/2, OPA1)

    • Fission machinery (Drp1, Fis1)

    • Toll-like receptor signaling components

    • Parkin and CHIP-IRF1 axis components

This comprehensive mapping approach will reveal the molecular mechanisms by which FAM73B coordinates mitochondrial morphology changes in response to immune stimulation.

What are the optimal conditions for expression and purification of recombinant Xenopus laevis FAM73B protein?

For optimal expression and purification of recombinant Xenopus laevis FAM73B protein, follow this detailed protocol:

  • Expression System Selection:

    • E. coli is the recommended expression system for FAM73B

    • BL21(DE3) strain typically yields good expression levels for mitochondrial proteins

    • Consider Rosetta or Origami strains if disulfide bonds are critical for function

  • Expression Vector Design:

    • Include N-terminal His-tag for efficient purification

    • Optimize codon usage for E. coli

    • Consider including a cleavable tag if the His-tag might interfere with function

  • Culture Conditions:

    • Grow cultures at 37°C until OD600 reaches 0.6-0.8

    • Induce with 0.5-1.0 mM IPTG

    • Reduce temperature to 18-25°C after induction

    • Continue expression for 16-18 hours at the lower temperature

  • Cell Lysis and Extraction:

    • Resuspend cells in Tris/PBS buffer (pH 8.0) with 6% Trehalose

    • Add protease inhibitors to prevent degradation

    • Use sonication or high-pressure homogenization for cell disruption

    • Include 0.5-1% mild detergent (e.g., Triton X-100) to solubilize membrane-associated protein

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Wash with increasing imidazole concentration (10-50 mM)

    • Elute with 250-300 mM imidazole

    • Consider secondary purification step (size exclusion chromatography)

  • Quality Control:

    • Verify purity by SDS-PAGE (target >90% purity)

    • Confirm identity by Western blot and/or mass spectrometry

    • Assess structural integrity through circular dichroism if functional studies are planned

This optimized protocol ensures high yield and purity of functional recombinant FAM73B protein suitable for downstream applications.

How can I troubleshoot low activity or instability issues with recombinant FAM73B protein?

When encountering low activity or instability issues with recombinant FAM73B protein, implement this systematic troubleshooting approach:

  • Protein Quality Assessment:

    • Verify protein purity using SDS-PAGE (>90% purity is recommended)

    • Confirm correct folding using circular dichroism spectroscopy

    • Assess aggregation state using dynamic light scattering or size exclusion chromatography

  • Storage and Handling Improvements:

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Add stabilizing agents such as glycerol (5-50%) to storage buffer

    • Consider alternative buffer systems if Tris/PBS is suboptimal

    • Maintain cold chain during all handling steps

  • Activity Optimization:

    • Test activity in different buffer conditions (varying pH, salt concentration)

    • Add cofactors that might be required for function

    • Include reducing agents (DTT, β-mercaptoethanol) if disulfide bonds affect function

    • Optimize protein concentration for activity assays

  • Structural Stabilization Strategies:

    • Add specific lipids if membrane interaction is critical for function

    • Consider detergent screening if the protein has hydrophobic domains

    • Test different temperatures for activity assays (4°C, 25°C, 37°C)

  • Expression System Reconsideration:

    • If E. coli-expressed protein remains problematic, consider eukaryotic expression systems

    • Evaluate insect cell or mammalian cell expression for proper post-translational modifications

    • Test co-expression with chaperones if folding appears to be an issue

Implementing these troubleshooting strategies systematically will help identify and resolve specific factors affecting FAM73B protein stability and activity.

How can Xenopus laevis FAM73B be utilized to study anti-tumor immune responses?

To leverage Xenopus laevis FAM73B in studying anti-tumor immune responses, implement the following research strategy:

  • Xenopus Tumor Models Development:

    • Establish transplantable tumor models in tadpoles or adult frogs

    • Develop FAM73B knockout/knockdown lines using CRISPR/Cas9 or morpholinos

    • Create conditional expression systems to modulate FAM73B levels in specific immune cell populations

  • Immune Response Characterization:

    • Analyze IL-12 production in FAM73B-deficient macrophages and dendritic cells

    • Measure T-cell activation markers following interaction with FAM73B-modified antigen-presenting cells

    • Assess natural killer (NK) cell activity in response to altered mitochondrial dynamics

  • Tumor Microenvironment Analysis:

    • Characterize metabolic profiles of tumor-associated macrophages with altered FAM73B expression

    • Examine mitochondrial morphology in situ using confocal microscopy

    • Evaluate infiltration patterns of immune cells in FAM73B-modified tumors

  • Mechanistic Studies:

    • Analyze the Parkin-CHIP-IRF1 axis in tumor contexts

    • Assess changes in mitochondrial fission/fusion balance in tumor cells vs. immune cells

    • Investigate crosstalk between TLR signaling and mitochondrial dynamics in anti-tumor immunity

  • Therapeutic Potential Evaluation:

    • Test compounds that modulate FAM73B activity or mitochondrial dynamics

    • Evaluate combination approaches targeting both FAM73B and checkpoint inhibitors

    • Develop strategies to enhance anti-tumor immunity by modulating mitochondrial fission

This comprehensive approach leverages the unique advantages of Xenopus as a model organism while focusing on the specific role of FAM73B in anti-tumor immune responses.

What insights does FAM73B function in Xenopus provide for understanding human mitochondrial diseases?

FAM73B function in Xenopus provides several valuable insights for understanding human mitochondrial diseases:

  • Evolutionary Conservation and Disease Relevance:

    • Xenopus FAM73B shares significant homology with human FAM73B (MIGA2)

    • The conserved function in mitochondrial dynamics suggests fundamental roles across vertebrates

    • Mutations affecting similar pathways in humans are associated with mitochondrial morphology disorders

  • Developmental Context of Mitochondrial Dynamics:

    • Xenopus enables study of mitochondrial fusion/fission during embryonic development

    • Temporal patterns of FAM73B expression correlate with crucial developmental transitions

    • Developmental phenotypes can reveal functions not apparent in cell culture systems

  • Mitochondrial Quality Control Mechanisms:

    • FAM73B's interaction with Parkin provides insights into mitophagy processes

    • The CHIP-IRF1 axis regulation has implications for human diseases with impaired mitochondrial quality control

    • Xenopus models can reveal tissue-specific requirements for these pathways

  • Immune System-Mitochondria Crosstalk:

    • FAM73B's role in TLR-mediated mitochondrial remodeling connects immune function to mitochondrial dynamics

    • This intersection is increasingly recognized in human inflammatory and autoimmune diseases

    • Xenopus models provide a platform to study this crosstalk in an intact organism

  • Translational Research Applications:

    • High-throughput screening in Xenopus can identify compounds that modulate FAM73B function

    • Such compounds could have therapeutic potential for human mitochondrial diseases

    • The cost-effectiveness of Xenopus facilitates rapid screening of candidate therapeutic approaches

This translational perspective highlights how basic mechanistic studies of FAM73B in Xenopus can inform our understanding of human mitochondrial diseases and potentially lead to novel therapeutic strategies.

How does Xenopus laevis FAM73B compare structurally and functionally to its human ortholog?

A comprehensive comparison of Xenopus laevis FAM73B (MIGA2) with its human ortholog reveals important evolutionary insights:

  • Sequence Homology and Conservation:

    • Xenopus FAM73B shares approximately 70-75% amino acid identity with human FAM73B

    • The mitochondrial targeting sequence and transmembrane domains show highest conservation

    • Key functional motifs involved in protein-protein interactions are preserved across species

  • Structural Features Comparison:

    FeatureXenopus FAM73BHuman FAM73B
    Amino Acid Length226 aa232 aa
    Transmembrane Domains2 predicted2 confirmed
    Conserved DomainsMitochondrial dynamicsMitochondrial dynamics
    Post-translational ModificationsMultiple predicted phosphorylation sitesPhosphorylation and ubiquitination sites confirmed
  • Functional Conservation:

    • Both proteins localize to the mitochondrial outer membrane

    • Both participate in mitochondrial fusion/fission dynamics

    • The role in TLR signaling appears conserved, though with species-specific variations

    • Interaction with the Parkin pathway is maintained across species

  • Species-Specific Adaptations:

    • Differences in regulatory regions suggest variations in expression patterns

    • Human FAM73B shows additional interaction partners not confirmed in Xenopus

    • Xenopus-specific interactions may reflect adaptation to its developmental program

  • Experimental Utility:

    • High conservation validates Xenopus as a model for studying basic FAM73B function

    • Differences highlight the importance of species-specific validation

    • The simpler Xenopus system can reveal core functions obscured in more complex mammals

This comparative analysis provides a framework for leveraging Xenopus studies to inform human biology while acknowledging important species-specific differences.

What advantages does the Xenopus model system offer for studying FAM73B compared to other model organisms?

The Xenopus model system offers distinct advantages for studying FAM73B compared to other model organisms:

  • Developmental Biology Advantages:

    • External fertilization and development allow easy access to all embryonic stages

    • Transparent embryos facilitate real-time imaging of mitochondrial dynamics

    • Large embryo size enables microinjection of mRNA, morpholinos, or CRISPR/Cas9 components

    • Well-characterized fate maps allow targeted manipulation of specific tissues

  • Experimental Efficiency:

    • High-throughput screening capacity due to large clutch sizes (thousands of embryos)

    • Rapid development accelerates experimental timelines

    • Cost-effectiveness compared to mammalian models

    • Ability to perform partial knockdown approaches to model hypomorphic conditions

  • Evolutionary Position:

    • As tetrapods, Xenopus are evolutionarily closer to humans than zebrafish

    • Simplified immune system compared to mammals, but with conserved components

    • Provides insights into conserved FAM73B functions across vertebrates

  • Technical Advantages:

    FeatureXenopusMouseZebrafishCell Culture
    Embryo AccessibilityExcellentLimitedGoodN/A
    Genetic ManipulationGoodExcellentGoodExcellent
    CostLowHighLowLow
    Development SpeedRapidSlowRapidN/A
    Imaging CapabilitiesExcellentLimitedExcellentGood
    Immune SystemSimplified vertebrateComplex mammalianSimplified vertebrateLimited
  • Specific FAM73B Research Advantages:

    • Ability to study mitochondrial dynamics in intact organisms during development

    • Capacity to examine immune-mitochondria crosstalk in vivo

    • Feasibility of creating tissue-specific FAM73B modifications

    • Opportunity to study evolutionary conservation of FAM73B function

These advantages position Xenopus as a valuable complementary system to mammalian models for comprehensive FAM73B research.

What emerging techniques could enhance our understanding of FAM73B function in Xenopus systems?

Several cutting-edge techniques show promise for advancing our understanding of FAM73B function in Xenopus systems:

  • Advanced Genetic Manipulation Approaches:

    • CRISPR activation/inhibition (CRISPRa/CRISPRi) for spatiotemporal control of FAM73B expression

    • Base editing for introducing precise point mutations to study structure-function relationships

    • Optogenetic tools to control FAM73B activity with light-inducible domains

    • Heat-shock inducible constructs for temporal control of expression

  • Advanced Imaging Technologies:

    • Super-resolution microscopy (STED, PALM/STORM) for nanoscale visualization of mitochondrial dynamics

    • Light sheet microscopy for whole-organism imaging of mitochondrial networks

    • FRET-based biosensors to detect FAM73B interactions in real-time

    • Correlative light and electron microscopy (CLEM) to link functional data with ultrastructural changes

  • Single-Cell and Spatial Omics:

    • Single-cell RNA-seq to characterize cell-type specific responses to FAM73B manipulation

    • Spatial transcriptomics to map expression patterns in developing Xenopus embryos

    • Proteomics of isolated mitochondria to identify FAM73B interaction networks

    • Metabolomics to assess functional consequences of altered mitochondrial dynamics

  • Organoid and Ex Vivo Systems:

    • Xenopus tissue explants to study FAM73B in simplified developmental contexts

    • Organoid systems derived from Xenopus cells with modified FAM73B expression

    • Ex vivo culture of Xenopus immune cells to study FAM73B in controlled environments

  • Computational and Systems Biology Approaches:

    • Machine learning algorithms to predict FAM73B interaction networks

    • Systems biology modeling of mitochondrial dynamics

    • Comparative genomics across species to identify functional domains

    • Structural prediction with AlphaFold or similar tools to generate high-resolution models

Implementation of these emerging techniques will significantly enhance our capacity to understand FAM73B's complex roles in mitochondrial biology and immune function within the Xenopus model system.

How might insights from Xenopus FAM73B research translate to therapeutic approaches for mitochondrial and immune disorders?

Insights from Xenopus FAM73B research offer several promising translational pathways for therapeutic development:

  • Target Identification and Validation:

    • Discovery of druggable sites within the FAM73B protein or its interaction partners

    • Validation of the FAM73B-regulated mitochondrial dynamics pathway as a therapeutic target

    • Identification of biomarkers associated with altered FAM73B function

    • Characterization of tissue-specific requirements for FAM73B function

  • Drug Discovery Applications:

    • High-throughput screening in Xenopus embryos to identify compounds that modulate FAM73B activity

    • In vivo validation of compounds identified in cell-based screens

    • Structure-based drug design targeting FAM73B or its interaction interfaces

    • Repurposing of existing drugs that affect mitochondrial dynamics

  • Immunomodulatory Strategies:

    • Development of approaches to enhance anti-tumor immunity by modulating FAM73B function

    • Identification of interventions that regulate IL-12 production through mitochondrial dynamics

    • Design of combination therapies targeting both immune checkpoints and mitochondrial function

    • Creation of cell-based therapies with engineered FAM73B expression

  • Gene Therapy Potential:

    • Xenopus studies can validate gene replacement strategies for FAM73B-related disorders

    • Identification of compensatory pathways that could be therapeutically enhanced

    • Development of RNA-based therapeutics targeting FAM73B or its regulatory networks

    • Proof-of-concept for mitochondrial-targeted gene therapy approaches

  • Precision Medicine Applications:

    • Functional testing of patient-derived variants in Xenopus systems

    • Development of personalized treatment strategies based on specific FAM73B mutations

    • Creation of disease models incorporating patient-specific genetic backgrounds

    • Identification of genetic modifiers that influence FAM73B-related phenotypes

The rapid, cost-effective nature of Xenopus research facilitates accelerated translation of basic insights into potential therapeutic approaches, particularly for disorders involving mitochondrial dynamics and immune dysfunction.

What is the recommended protocol for studying mitochondrial dynamics in Xenopus embryos with FAM73B modifications?

For optimal investigation of mitochondrial dynamics in Xenopus embryos with FAM73B modifications, follow this comprehensive protocol:

  • Embryo Generation and Genetic Modification:

    • Induce ovulation in female Xenopus using human chorionic gonadotropin

    • Perform in vitro fertilization and maintain embryos in 0.1× Marc's Modified Ringer's solution

    • For FAM73B knockdown: inject morpholinos (25-50 ng) at 1-4 cell stage

    • For CRISPR/Cas9 knockout: inject Cas9 protein (500 pg) with sgRNA (300 pg) targeting FAM73B

    • For overexpression: inject FAM73B mRNA (500-1000 pg) synthesized using mMessage mMachine kit

  • Mitochondrial Labeling for Live Imaging:

    • Inject embryos with mRNA encoding mitochondrially-targeted fluorescent proteins (mito-GFP, mito-RFP)

    • Alternatively, incubate stage 25-30 embryos with MitoTracker dyes (100-500 nM, 30 minutes at 23°C)

    • For membrane potential analysis, use JC-1 dye (5 μg/ml, 30 minutes at 23°C)

    • Wash embryos thoroughly before imaging

  • Advanced Imaging Setup:

    • Use confocal microscopy with high NA objectives (60-100×)

    • For deep tissue imaging, employ two-photon microscopy

    • For whole-embryo visualization, use light sheet microscopy

    • Maintain embryos in imaging chambers at 18-23°C during acquisition

  • Quantitative Analysis of Mitochondrial Morphology:

    • Measure mitochondrial length, branching, and interconnectivity using ImageJ with MitoTools plugin

    • Quantify fusion/fission events in time-lapse recordings (1 frame/5-10 seconds)

    • Calculate mitochondrial density and distribution patterns

    • Perform batch analysis using automated image processing pipelines

  • Biochemical and Molecular Validation:

    • Extract mitochondria from embryos at various stages using differential centrifugation

    • Assess expression of fusion (Mfn1/2, OPA1) and fission (Drp1, Fis1) proteins by Western blotting

    • Measure ATP production and oxygen consumption in isolated mitochondria

    • Analyze expression of mitochondrial genes by qPCR

  • Functional Correlations:

    • Relate mitochondrial morphology changes to developmental outcomes

    • In immune studies, correlate dynamics with cytokine production (IL-12)

    • For neuronal tissues, assess impact on neurite outgrowth and synaptogenesis

    • In muscle, evaluate effects on contractile function

This comprehensive protocol enables detailed characterization of how FAM73B modifications affect mitochondrial dynamics across different tissues and developmental stages.

How can researchers effectively validate FAM73B knockout or knockdown in Xenopus systems?

To effectively validate FAM73B knockout or knockdown in Xenopus systems, implement this multi-level verification strategy:

  • Genomic Validation for CRISPR/Cas9 Editing:

    • PCR amplification of target region followed by sequencing

    • T7 Endonuclease I assay to detect indels

    • Restriction fragment length polymorphism (RFLP) if edit introduces/removes restriction sites

    • Deep sequencing for quantitative assessment of editing efficiency

    • Establish breeding colony from F0 founders with confirmed germline transmission

  • RNA Expression Analysis:

    • Quantitative RT-PCR with primers specific to FAM73B

    • RNA-seq for global transcriptome analysis and off-target effects

    • In situ hybridization to confirm tissue-specific knockdown

    • Northern blotting for complete transcript verification

    • Analysis of splicing patterns if intronic regions were targeted

  • Protein Level Verification:

    • Western blotting using antibodies against FAM73B or His-tagged protein

    • Immunofluorescence microscopy to verify loss of mitochondrial localization

    • Mass spectrometry-based proteomics of mitochondrial fractions

    • Proximity labeling to assess changes in protein interaction networks

    • Functional complementation with recombinant protein to rescue phenotypes

  • Morpholino-Specific Controls:

    • Use of standard control morpholinos at equivalent concentrations

    • Rescue experiments with morpholino-resistant mRNA constructs

    • Dose-response analysis to establish specificity

    • Comparison of phenotypes with CRISPR knockout for validation

    • Use of second non-overlapping morpholino targeting the same gene

  • Functional Readouts:

    • Mitochondrial morphology assessment (fusion/fission balance)

    • Analysis of IL-12 production following TLR stimulation

    • Evaluation of Parkin recruitment to mitochondria

    • Measurement of mitochondrial membrane potential

    • Assessment of cellular responses to metabolic stress

This comprehensive validation approach ensures reliable interpretation of experimental results by confirming FAM73B modification at multiple biological levels.

What resources are available for researchers new to working with Xenopus models and recombinant proteins?

For researchers new to Xenopus models and recombinant protein work, the following comprehensive resources are available:

  • Xenopus-Specific Research Resources:

    • Xenbase (http://www.xenbase.org/): The primary Xenopus model organism database containing genomic data, gene expression patterns, and research protocols

    • Normal Table of Xenopus Development: A new open-access resource with 133 high-quality illustrations of X. laevis development from fertilization to metamorphosis

    • Landmarks Table: A compilation of key morphological features and marker gene expression for accurate staging (https://www.xenbase.org/entry/landmarks-table.do)

    • The Xenopus Community Resource Portal: Provides access to transgenics, antibodies, and training opportunities

  • Practical Training Opportunities:

    • Cold Spring Harbor Laboratory Course on Cell and Developmental Biology of Xenopus

    • National Xenopus Resource (NXR) workshops and courses

    • European Xenopus Resource Centre (EXRC) training programs

    • Virtual workshops on specific techniques (CRISPR editing, imaging, etc.)

  • Recombinant Protein Resources:

    • Detailed protocols for expression and purification of His-tagged proteins from E. coli

    • Commercial sources for recombinant Xenopus proteins including FAM73B

    • Plasmid repositories (Addgene, Xenbase) containing expression vectors

    • Quality control guidelines for recombinant protein characterization

  • Method-Specific Protocols and Guides:

    Resource TypeDescriptionAccess
    Protocol CollectionsDetailed methods for Xenopus researchCSH Protocols, Xenbase
    Video TutorialsVisual guides for embryo manipulationJoVE, YouTube channels
    Equipment GuidesMicroinjection and imaging setupsManufacturer websites
    Software ToolsAnalysis programs for developmental biologyOpen-source repositories
  • Community Support Networks:

    • Xenopus electronic mailing list (Xine-list)

    • Annual International Xenopus Conference

    • Regional Xenopus meetings and workshops

    • Social media groups dedicated to Xenopus research

These diverse resources enable new researchers to quickly acquire the necessary knowledge and skills for effective work with Xenopus models and recombinant proteins like FAM73B.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.