Recombinant Xenopus laevis Protein Mpv17 (mpv17)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Research Implications

MPV17 is a conserved mitochondrial protein with roles in maintaining organelle homeostasis. While Xenopus laevis MPV17 has not been extensively studied, insights are drawn from homologous proteins in mammals and yeast:

Core Functions

FunctionMechanismRelevance
Non-selective channelModulates mitochondrial membrane potential (Δψm)Maintains mitochondrial homeostasis
ROS regulationElevates ROS production in deficiency; channel may regulate ROS levelsLinked to oxidative stress and damage
mtDNA maintenanceDeficiency causes mtDNA depletion and replication issuesAssociated with mitochondrial diseases
Apoptosis modulationPromotes β-cell apoptosis in diabetes models (homolog studies)Potential role in disease pathology

Mechanistic Insights

  • Channel Activity: MPV17 forms a non-selective channel (pore diameter: ~1.8 nm) that regulates Δψm. This modulation prevents excessive ROS production under stress .

  • mtDNA Depletion: Mutations in MPV17 disrupt mtDNA replication, likely due to impaired dNTP pool maintenance .

  • Oxidative Stress Sensitivity: Deficiency elevates ROS, exacerbating mitochondrial damage and apoptosis .

Experimental Uses

ApplicationPurpose
Mitochondrial Membrane AssaysInvestigate Δψm modulation and channel gating under redox/pH stress
ROS MeasurementAssess oxidative stress responses in Xenopus cell lines or embryos
mtDNA Stability StudiesEvaluate replication deficits in MPV17-deficient systems
Protein-Protein InteractionsIdentify binding partners (e.g., MICOS complex, ATP synthase)

Model Organism Relevance

  • Xenopus laevis* is a key model for studying embryogenesis and organ development. MPV17’s role in mitochondrial function positions it as a candidate for investigating developmental defects linked to mtDNA depletion or oxidative stress .

Production Protocol

  1. Expression: Cloned into bacterial vectors (e.g., pET) and expressed in E. coli under optimized conditions.

  2. Purification: His-tag affinity chromatography followed by size-exclusion chromatography .

  3. Quality Control: SDS-PAGE confirms >90% purity, and mass spectrometry validates identity .

Sequence and Structure

The Xenopus laevis MPV17 sequence (1–177 aa) aligns with conserved domains in human and yeast orthologs, including:

  • Channel Region: Hydrophobic transmembrane domains facilitating non-selective ion transport .

  • Regulatory Sites: Cysteine residues (redox-sensitive) and phosphorylation motifs (pH/voltage-dependent gating) .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, if you have any special requirements for the format, please specify them in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us during your order placement. We will prioritize the development of the specified tag if feasible.
Synonyms
mpv17; Protein Mpv17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
mpv17
Target Protein Sequence
MAGLWRAYQRLLGAHPWKVQIVTAGSLVGVGDVISQQLLERKGLKGHSIERTVKMMGIGF CFVGPVVGGWYKILDRIIPGSGKPVALKKMLLDQVAFAPCFLGCFLSIASALNGLSGEQI WGKLKRDYKDALITNYYIWPAVQVANFYFIPLYHRLAVVQFVAIIWNSYLSWKANKS
Uniprot No.

Target Background

Function
Mpv17 plays a crucial role in mitochondrial homeostasis, regulating oxidative phosphorylation and the maintenance of mitochondrial DNA (mtDNA). It functions as a non-selective channel that modulates the membrane potential under both normal conditions and oxidative stress.
Database Links

KEGG: xla:446961

UniGene: Xl.35336

Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Xenopus laevis Protein Mpv17?

Recombinant Xenopus laevis Protein Mpv17 is a full-length protein (177 amino acids) derived from the African clawed frog (Xenopus laevis). The protein is typically produced with an N-terminal His-tag through recombinant expression in E. coli systems. The protein corresponds to UniProt ID Q66GV0 and contains the complete amino acid sequence (1-177aa) of the native Xenopus laevis MPV17 protein . MPV17 functions as a non-selective channel in the inner mitochondrial membrane and plays important roles in mitochondrial function and homeostasis .

What are the key specifications of commercially available Recombinant Xenopus laevis MPV17?

The following table provides the standard specifications for commercially available Recombinant Xenopus laevis MPV17:

SpecificationDetails
SpeciesXenopus laevis
Expression SystemE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-177aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C, avoid repeated freeze-thaw cycles
UniProt IDQ66GV0

Table 1: Standard specifications for Recombinant Xenopus laevis MPV17 protein

What is the recommended reconstitution protocol for lyophilized Xenopus laevis MPV17?

For optimal reconstitution of lyophilized Xenopus laevis MPV17 protein:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute using deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is typically recommended)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage or at 4°C for short-term use (up to one week)

This reconstitution approach helps maintain protein stability and activity while minimizing degradation during storage.

How does MPV17 function in mitochondrial biology?

MPV17 functions as a non-selective channel in the inner mitochondrial membrane with important roles in maintaining mitochondrial homeostasis. Research indicates that:

  • The protein is critical for proper mitochondrial function and bioenergetics

  • Deficiency of MPV17 is associated with decreased resazurin reduction capacity, indicating impaired mitochondrial oxidative function

  • MPV17 appears to support mitochondrial membrane potential maintenance

  • The protein has been implicated in cellular redox homeostasis, as deficiencies can lead to increased reactive oxygen species (ROS) production

  • MPV17 may play a role in mitochondrial DNA (mtDNA) stability, although direct effects on mtDNA levels have shown variable results across experimental models

These functions highlight MPV17's importance in energy metabolism and mitochondrial integrity.

What are the appropriate controls when working with recombinant MPV17 in experimental settings?

When designing experiments with recombinant Xenopus laevis MPV17, the following controls should be considered:

  • Negative controls:

    • Empty vector transfection controls when expressing MPV17 in cell systems

    • Untransfected cells to assess baseline parameters

    • Non-targeting shRNA controls when performing knockdown experiments

  • Positive controls:

    • Wild-type MPV17 expression when studying mutant variants

    • Known mitochondrial markers (e.g., COX-IV) for subcellular fractionation quality control

    • Established mitochondrial stress inducers when assessing functional responses

  • Technical controls:

    • Tag-only protein controls to account for tag-related effects

    • Species-matched MPV17 from other organisms for comparative studies

    • Housekeeping genes (e.g., actin) for normalization in expression analyses

Proper controls ensure experimental rigor and reliable interpretation of results.

How can I assess the functional impact of MPV17 mutations or deficiency in cellular models?

To comprehensively evaluate the functional consequences of MPV17 mutations or deficiency, a multi-parameter approach is recommended:

This approach provides a comprehensive understanding of how MPV17 alterations affect mitochondrial function and cellular metabolism.

What methodological approaches can resolve conflicting data regarding MPV17's impact on mtDNA levels?

Research has yielded inconsistent results regarding MPV17's effects on mitochondrial DNA levels. To resolve these discrepancies:

  • Standardized mtDNA quantification:

    • Use RT-qPCR with multiple mitochondrial and nuclear gene targets

    • Normalize mtDNA copy number to nuclear DNA using at least two reference genes

    • Perform analyses at multiple time points to capture dynamic changes

  • Cell type considerations:

    • Compare results across different cell types (e.g., HEK293T vs. hepatic cell lines)

    • Correlate findings with tissue-specific expression patterns of MPV17

    • Consider compensatory mechanisms that may mask effects in certain cell types

  • Experimental condition optimization:

    • Test cells under both standard and metabolically challenging conditions

    • Include glucose limitation, galactose medium, or hypoxia to stress mitochondrial function

    • Assess mtDNA levels during cellular proliferation versus quiescence

  • Complementary approaches:

    • Combine quantitative PCR with fluorescence microscopy using mtDNA-specific probes

    • Assess mtDNA integrity alongside copy number measurements

    • Evaluate mtDNA replication rates using BrdU incorporation

How do different MPV17 mutations affect protein stability and mitochondrial function?

Different mutations in MPV17 can have variable impacts on protein stability and function. Analysis shows:

  • Protein stability effects:

    • Most pathogenic mutations destabilize the MPV17 protein, resulting in reduced protein levels

    • Western blot analysis with anti-MPV17 antibodies can quantify these reductions

    • Some mutations affect protein folding more severely than others

  • Mutation-specific functional effects:

    • R50W mutation: Associated with significantly increased lactate levels (up to 8-fold) compared to wild-type

    • G94R mutation: Linked to loss of mitochondrial membrane potential

    • S170F mutation: Results in significant loss of membrane potential in steady-state cells

  • Cellular consequences:

    • Different mutations show variable impacts on ROS production

    • Mutations differentially affect oxygen consumption rates

    • Some mutations cause protein mislocalization, preventing proper mitochondrial targeting

    • Most mutations lead to increased dependence on glycolytic ATP production

This heterogeneity in mutation effects highlights the importance of characterizing specific variants when studying MPV17-related disorders.

What protein expression systems are optimal for producing functional recombinant Xenopus laevis MPV17?

For producing high-quality recombinant Xenopus laevis MPV17:

  • Bacterial expression systems:

    • E. coli is the standard expression system for MPV17 production

    • BL21(DE3) or Rosetta strains optimize expression of eukaryotic proteins

    • Induction conditions: typically 0.5-1.0 mM IPTG at 18-25°C for 4-16 hours

    • Inclusion of protease inhibitors during purification preserves protein integrity

  • Mammalian expression systems:

    • HEK293T cells allow for post-translational modifications

    • Transfection with pcDNA3.1 constructs containing MPV17 with C-terminal tags

    • Expression verification using Western blotting with anti-MPV17 or anti-tag antibodies

    • Mitochondrial targeting can be confirmed using subcellular fractionation

  • Protein purification approach:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Buffer optimization to maintain protein stability and prevent aggregation

    • Size exclusion chromatography as a secondary purification step

    • Quality control via SDS-PAGE and Western blotting

The expression system should be selected based on the specific experimental requirements and downstream applications.

What are the recommended methods for studying MPV17 knockdown effects in cellular models?

To effectively study MPV17 knockdown effects:

  • Knockdown approach selection:

    • shRNA-based knockdown using validated constructs (e.g., TRCN0000129921)

    • CRISPR-Cas9 for complete gene knockout

    • Inducible knockdown systems for temporal control of expression

  • Validation of knockdown efficiency:

    • RT-qPCR to quantify mRNA levels

    • Western blotting to confirm protein reduction

    • Immunofluorescence to assess remaining protein localization

    • Normalization to appropriate housekeeping genes/proteins

  • Functional assessments:

    • Resazurin reduction assay to measure metabolic activity

    • Seahorse analysis to evaluate mitochondrial respiration

    • Assessment of mtDNA levels using RT-qPCR

    • Cell viability and proliferation measurements to distinguish between these parameters

  • Rescue experiments:

    • Reintroduction of wild-type MPV17 to confirm knockdown specificity

    • Expression of mutant variants to compare with knockdown phenotype

    • Use of species-matched or cross-species MPV17 to assess functional conservation

These approaches provide comprehensive insights into MPV17's cellular roles while maintaining experimental rigor.

What are common challenges in handling reconstituted MPV17 protein and how can they be addressed?

Researchers frequently encounter several challenges when working with reconstituted MPV17 protein:

  • Protein instability issues:

    • Challenge: Protein degradation during storage

    • Solution: Add glycerol (50% final concentration) and store in small aliquots

    • Validation: Run periodic SDS-PAGE to confirm protein integrity

  • Aggregation problems:

    • Challenge: Protein aggregation after reconstitution

    • Solution: Centrifuge briefly before opening vials; reconstitute slowly at lower concentrations

    • Validation: Check solution clarity and filter if necessary through 0.22 μm filter

  • Freeze-thaw degradation:

    • Challenge: Loss of activity with repeated freeze-thaw cycles

    • Solution: Store working aliquots at 4°C for up to one week; avoid repeated freezing

    • Validation: Compare activity of fresh vs. frozen-thawed samples

  • Buffer compatibility issues:

    • Challenge: Incompatibility with experimental buffers

    • Solution: Test buffer exchange methods and optimize compositions

    • Validation: Assess protein stability in each buffer system before experiments

Proper handling according to these guidelines ensures maximum protein stability and experimental reproducibility.

How can researchers distinguish between direct effects of MPV17 deficiency and secondary metabolic adaptations?

Differentiating primary effects from secondary adaptations requires careful experimental design:

  • Temporal analysis approach:

    • Implement time-course experiments after MPV17 knockdown/mutation

    • Monitor parameters at early (24-48h) vs. late (>72h) time points

    • Early alterations more likely represent direct effects of MPV17 deficiency

  • Metabolic flux analysis:

    • Use isotope tracing (e.g., 13C-glucose) to track metabolic pathway activities

    • Compare acute vs. chronic MPV17 deficiency effects on pathway utilization

    • Identify compensatory metabolic rewiring in response to sustained deficiency

  • Inducible expression systems:

    • Employ systems allowing rapid induction/repression of MPV17 expression

    • Compare acute phenotypes with those observed in stable knockdown lines

    • Rapid phenotypic changes upon manipulation suggest direct relationships

  • Complementation studies:

    • Perform rescue experiments with wild-type and mutant MPV17 variants

    • Rapid reversal of phenotypes indicates direct MPV17-dependent processes

    • Delayed or partial rescue suggests secondary adaptations requiring time to resolve

These approaches help establish causality in the complex metabolic landscape affected by MPV17 alterations.

What experimental design considerations are important when comparing MPV17 function across different species?

When conducting comparative studies of MPV17 across species:

  • Sequence and structural analysis:

    • Perform sequence alignments of MPV17 proteins across species

    • Identify conserved domains, motifs, and post-translational modification sites

    • Map known mutations/variants to conservation hotspots

  • Expression system standardization:

    • Express proteins from different species under identical conditions

    • Use the same tags and vector systems to minimize technical variables

    • Verify comparable expression levels across constructs

  • Cross-species complementation:

    • Test if human MPV17 can rescue phenotypes in Xenopus MPV17-deficient models

    • Evaluate whether Xenopus MPV17 can rescue human cell MPV17 deficiency

    • Quantify the degree of functional conservation through rescue efficiency

  • Physiological context considerations:

    • Account for species-specific metabolic differences

    • Consider differences in mitochondrial biology across species

    • Adjust experimental conditions to the physiological context of each organism

  • Data normalization strategies:

    • Establish appropriate internal controls for each species

    • Normalize data to account for baseline differences in mitochondrial content/activity

    • Present relative changes rather than absolute values when making direct comparisons

These considerations ensure meaningful cross-species comparisons and highlight evolutionarily conserved MPV17 functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.