Recombinant Xenopus laevis Protein odr-4 homolog (odr4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
odr4; Protein odr-4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
odr4
Target Protein Sequence
MGRSYYVDDRVEKYFSKLVQQQKACITGLIIGQYSSQRDYAVLTAQTPQKEDQNEEKKPG LSKLEEIDDEWVSMHASQVGRMLPGGLMVLGVFLMTTPDLSKDAQTILRKLVFAVEKSSM KNRLWNFDEDDVSERVTLHICSSTKKITCRTYDINDPKSTPKPADWKYQNSVLSWLTVDC NVRVDVTIPLTSPSLTYQERQKSIRLGLVKWTKEIEDSVVLFNGQYKDKNGDLFEEQKKS SRSSSHYSPQIITANFLNASPLIDNTRSTALVQPCKSSLTIQGVMKCRGFIHSNRPKVKD AMQAIKRDLLNTIQDRCELLFEDMMLNGPSNENDACPLPQRVFVPINGSNLKLCDYLFGD ETTSDLQSHFLEIMDQEVEQNELDFTEKKCELAHPEKRESEPASQHLESKPENKARSSST SLLNKGLVISTIVASIAIIISFYYIM
Uniprot No.

Target Background

Function

May play a role in the trafficking of a subset of G-protein coupled receptors.

Database Links

KEGG: xla:779082

UniGene: Xl.15391

Protein Families
ODR-4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis Protein odr-4 homolog (odr4) and what is its significance in research?

Xenopus laevis Protein odr-4 homolog (odr4) is a 446-amino acid protein (UniProt ID: A3KNB6) that belongs to the broader family of Receptor Transporter Proteins (RTPs). This protein has gained significance in research due to its potential roles in multiple biological processes, particularly in immune responses. RTPs in vertebrates, including those in Xenopus laevis, are multi-function proteins that regulate cell-surface G-protein coupled receptor levels, influence development, regulate immune signaling, and may directly inhibit viral infection . Unlike mammalian systems where RTPs are more extensively studied, the Xenopus laevis odr4 represents an opportunity to investigate evolutionary conservation and diversification of these proteins in amphibian models, providing comparative insights across vertebrate lineages.

How does the evolutionary history of odr4 in Xenopus laevis compare to other vertebrate species?

The evolutionary history of odr4 in Xenopus laevis represents a fascinating case of gene family expansion and functional diversification. While most vertebrate species typically possess 1-4 RTP family members, Xenopus laevis demonstrates a striking expansion with 11 RTPs identified in this species . This expansion suggests potential species-specific adaptations that may relate to the unique ecological niche and developmental patterns of Xenopus.

RNA sequencing data demonstrates that most Xenopus laevis RTPs, including odr4 homologs, are upregulated following immune stimulation, indicating a potential role in immune responses . This functional adaptation may represent a unique evolutionary solution to pathogen challenges faced by amphibians in their aquatic environment.

What are the optimal storage and handling conditions for recombinant odr4 protein?

For optimal stability and activity of recombinant Xenopus laevis odr4 protein, the following storage and handling protocols are recommended:

Storage ParameterRecommendation
Long-term storage-20°C/-80°C upon receipt
Working aliquots4°C for up to one week
AliquotingNecessary for multiple use
Freeze-thaw cyclesAvoid repeated cycles

Prior to opening, the vial should be briefly centrifuged to bring the contents to the bottom. The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and to aliquot the solution to avoid repeated freeze-thaw cycles that can compromise protein integrity .

When handling the protein for experimental purposes, researchers should maintain the protein in appropriate buffer conditions (Tris/PBS-based, pH 8.0) and minimize exposure to proteases and extreme temperatures that could lead to denaturation.

What expression systems are most effective for producing recombinant Xenopus laevis odr4?

E. coli expression systems have been successfully employed for the production of recombinant Xenopus laevis odr4 protein, as demonstrated by commercially available preparations . The bacterial expression approach is advantageous for producing substantial quantities of protein for biochemical and structural studies. When using E. coli for expression, codon optimization may be necessary to overcome potential codon bias issues between amphibian and bacterial genomes.

For functional studies requiring post-translational modifications, alternative expression systems should be considered. Mammalian cell expression systems (such as HEK293 or CHO cells) might better preserve potential glycosylation patterns or other modifications that could be essential for protein function. In some cases, the Xenopus oocyte expression system itself can be utilized, particularly when studying protein function in a more native context.

The choice of expression system should be guided by the specific research questions being addressed:

Research FocusRecommended Expression System
Structural studiesE. coli (high yield, simpler purification)
Functional assaysMammalian cells (proper folding and modifications)
In vivo interactionsXenopus oocyte system (native context)

How can morpholino oligonucleotides be used to study odr4 function in Xenopus development?

Morpholino oligonucleotides (MOs) represent a powerful approach for studying odr4 function in Xenopus development through targeted gene knockdown. This method is particularly advantageous in Xenopus models because:

  • MOs are effective post-fertilization, allowing study of gene function throughout early development

  • They can be used in both Xenopus laevis and Xenopus tropicalis, enabling comparative studies

  • The technique has been well-established in Xenopus systems with documented protocols

When designing a study using MOs to target odr4, researchers should:

  • Design antisense MOs that specifically target the translation start site or splice junctions of odr4 mRNA

  • Include appropriate controls, such as a standard control MO with no specific target

  • Validate knockdown efficiency through Western blotting or immunostaining

  • Perform rescue experiments by co-injecting MO-resistant odr4 mRNA to confirm specificity

For embryological applications, MOs can be microinjected into specific blastomeres at early cleavage stages to study region-specific functions of odr4. The large size of Xenopus embryos facilitates such targeted injections, allowing for sophisticated loss-of-function analyses in specific tissues or regions . MOs remain effective for the first few days of development, which includes the period of early organogenesis, making them ideal for studying developmental roles of odr4.

What is the relationship between odr4 and the Receptor Transporter Protein (RTP) family?

The odr4 protein in Xenopus laevis is a member of the broader Receptor Transporter Protein (RTP) family, which exhibits diverse functions across vertebrate species. The relationship between odr4 and other RTP family members reveals important evolutionary and functional insights:

  • Phylogenetic position: Odr4 represents one of the 11 RTP family members identified in Xenopus laevis, which is a notable expansion compared to most vertebrate species that typically possess only 1-4 RTPs

  • Functional diversity: While mammalian RTPs are known to regulate cell-surface G-protein coupled receptor levels, influence olfactory system development, regulate immune signaling, and directly inhibit viral infection, the specific functions of Xenopus odr4 continue to be investigated

  • Immune connection: RNA sequencing has revealed that most Xenopus laevis RTPs, potentially including odr4, are upregulated following immune stimulation, suggesting immunological functions

  • Antiviral activity: At least three Xenopus laevis RTPs have demonstrated inhibition of RNA virus infection, suggesting that odr4 might share similar antiviral properties, extending RTP antiviral function beyond mammals

This relationship highlights the possibility that odr4 may serve multiple biological functions in Xenopus, participating in both developmental processes and immune responses, similar to its RTP family relatives but potentially with amphibian-specific adaptations.

What experimental approaches are recommended for studying odr4 localization in Xenopus cells?

To study the subcellular localization of odr4 in Xenopus cells, several complementary experimental approaches are recommended:

Immunohistochemistry Protocol:

  • Fix Xenopus embryos or tissues with 4% paraformaldehyde

  • Permeabilize with 0.1% Triton X-100

  • Block with 5% normal goat serum

  • Incubate with primary antibodies against odr4 (either commercial or custom-generated)

  • Apply fluorescently-labeled secondary antibodies

  • Counterstain with DAPI for nuclear visualization

  • Image using confocal microscopy

Importantly, antibodies that react against Xenopus laevis proteins can effectively detect the Xenopus tropicalis protein using established immunohistochemistry procedures, enabling comparative studies between species .

Fluorescent Fusion Protein Approach:

  • Generate constructs expressing odr4 fused to fluorescent proteins (GFP, mCherry)

  • Microinject mRNA encoding these fusion proteins into Xenopus embryos

  • Visualize protein localization in live embryos using fluorescence microscopy

  • Perform time-lapse imaging to track dynamic localization during development

Biochemical Fractionation:

  • Homogenize Xenopus tissues or cells

  • Perform subcellular fractionation to isolate membrane, cytosolic, and nuclear fractions

  • Analyze fractions by Western blotting using anti-odr4 antibodies

  • Quantify relative distribution across cellular compartments

These approaches can be combined to provide comprehensive insights into odr4 localization patterns during different developmental stages and in response to various stimuli, particularly immune challenges given the protein's potential immunological functions.

How can CRISPR-Cas9 genome editing be applied to study odr4 function in Xenopus models?

CRISPR-Cas9 genome editing offers powerful approaches for studying odr4 function in Xenopus models, complementing traditional methods like morpholino knockdown. While Xenopus laevis presents challenges due to its allotetraploid genome, Xenopus tropicalis, with its diploid genome, provides an excellent alternative for genetic manipulation .

Methodological Approach:

  • Design guide RNAs (gRNAs) targeting conserved regions of the odr4 gene

    • Use Xenopus-specific CRISPR design tools to minimize off-target effects

    • Target early exons to ensure functional disruption

  • Prepare CRISPR components for embryo injection

    • Synthesize gRNAs in vitro

    • Purify Cas9 protein or prepare Cas9 mRNA

  • Microinject CRISPR components into fertilized eggs

    • One-cell stage injection for whole-organism knockout

    • Later stage or blastomere-specific injection for mosaic analysis

  • Validate genome editing efficiency

    • T7 endonuclease assay or sequencing to confirm mutations

    • RT-PCR and Western blot to verify reduced mRNA/protein levels

  • Phenotypic analysis

    • Assess developmental phenotypes

    • Perform molecular and cellular analyses

    • Conduct immune challenge experiments if investigating immune functions

Advantages in Xenopus tropicalis:

  • Diploid genome simplifies genetic analysis

  • Shorter generation time (4-6 months versus 12-18 months for X. laevis)

  • Smaller genome facilitates comprehensive analysis

For studying specific domains or functions of odr4, precise editing approaches such as homology-directed repair (HDR) can be employed to introduce specific mutations or reporter tags. This approach enables detailed structure-function analyses of the odr4 protein in its endogenous context.

What evidence suggests potential roles for odr4 in antiviral immunity?

Several lines of evidence suggest potential roles for odr4 in antiviral immunity, particularly within the context of RTP family functions in Xenopus laevis:

  • Evolutionary expansion: The striking expansion of RTPs in Xenopus laevis (11 RTPs compared to 1-4 in most other species) suggests specialized functions that may include enhanced immune capabilities

  • Gene expression patterns: RNA sequencing has revealed that most Xenopus laevis RTPs are upregulated following immune stimulation, indicating involvement in immune responses

  • Functional assays: Experimental evidence demonstrates that at least three Xenopus laevis RTPs inhibit infection by RNA viruses, suggesting that RTP homologs including odr4 may serve as antiviral effectors outside of Mammalia

  • Positive selection signatures: Many vertebrate RTP clades, including those in Xenopus, show signatures of positive selection, which often characterizes genes involved in host-pathogen interactions

  • Structural features: Analysis of odr4's amino acid sequence reveals features consistent with membrane association, which could be relevant for viral inhibition at cellular membranes where many viruses replicate or assemble

These findings suggest that odr4 may contribute to antiviral defense mechanisms in Xenopus, representing an example of convergent evolution of immune functions across vertebrate lineages or conservation of ancestral antiviral mechanisms.

How can recombinant odr4 protein be used in functional studies?

Recombinant Xenopus laevis odr4 protein can be employed in multiple functional studies to elucidate its biological roles:

Protein-Protein Interaction Studies:

  • Pull-down assays using His-tagged recombinant odr4 to identify binding partners

  • Co-immunoprecipitation experiments in Xenopus extracts

  • Surface plasmon resonance (SPR) to determine binding kinetics with suspected interactors

  • Yeast two-hybrid screening to identify novel protein interactions

Structural Studies:

  • X-ray crystallography to determine three-dimensional structure

  • Circular dichroism spectroscopy to analyze secondary structure elements

  • Limited proteolysis to identify domain boundaries and flexible regions

Cellular Assays:

  • Cell-based viral infection assays to test antiviral properties, particularly against RNA viruses

  • Receptor trafficking studies in Xenopus oocytes or mammalian cell lines

  • Immunomodulation assays measuring cytokine responses in immune cells

In Vitro Biochemical Assays:

  • Lipid binding assays to test membrane association

  • ATP/GTP hydrolysis assays to test for enzymatic activity

  • In vitro transcription/translation systems to study effects on protein synthesis

The recombinant protein's high purity (>90% as determined by SDS-PAGE) makes it suitable for these diverse applications. For each application, researchers should consider appropriate buffer conditions and potential need for refolding depending on the specific requirements of the assay.

What are the optimal reconstitution methods for lyophilized recombinant odr4 protein?

Proper reconstitution of lyophilized recombinant odr4 protein is critical for maintaining its structural integrity and biological activity. The following protocol is recommended:

Recommended Reconstitution Protocol:

  • Centrifuge the vial briefly prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Prepare multiple small aliquots to minimize freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

Buffer Considerations:

The protein is supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 . This formulation helps maintain stability during the lyophilization process and subsequent reconstitution. For specific applications, researchers may need to dialyze the protein into alternative buffers, but should maintain pH in the range of 7.5-8.5 to ensure stability.

Quality Control Measures:

After reconstitution, it is advisable to:

  • Verify protein concentration using standard methods (BCA assay, Bradford assay)

  • Confirm protein integrity by SDS-PAGE

  • Test functional activity in a relevant assay before proceeding with critical experiments

For working with the reconstituted protein, aliquots can be stored at 4°C for up to one week . Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity.

What advantages does Xenopus tropicalis offer over Xenopus laevis for odr4 research?

Xenopus tropicalis offers several significant advantages over Xenopus laevis for odr4 research, particularly for genetic and genomic approaches:

Genomic Advantages:

  • Diploid genome versus allotetraploid in X. laevis, simplifying genetic analysis and manipulation

  • Smaller genome size (1.7 Gb compared to 3.1 Gb in X. laevis), facilitating genome sequencing and assembly

  • Higher quality genome assembly and annotation, enabling more precise genetic targeting

Developmental Advantages:

  • Shorter generation time (4-6 months versus 12-18 months for X. laevis), accelerating genetic studies

  • Similar developmental patterns to X. laevis, allowing comparative developmental studies

  • Developmental staging system of Nieuwkoop and Faber applicable to both species, facilitating cross-species comparisons

Experimental Compatibility:

  • Many X. laevis tools can be directly applied to X. tropicalis:

    • Whole-mount in situ hybridization protocols work without alteration

    • X. laevis probes often work in X. tropicalis, eliminating the need to clone orthologs

    • Antibodies against X. laevis proteins typically detect X. tropicalis proteins

    • Morpholino oligonucleotides function effectively in both species

Research Applications:

  • Forward genetic screening more feasible in X. tropicalis

  • CRISPR-Cas9 genome editing more straightforward in diploid X. tropicalis

  • Gynogenetic diploid embryo generation for recessive mutation screens

While X. tropicalis offers these advantages, researchers should note that it tolerates a narrower range of temperatures compared to X. laevis , which may require more precise environmental control during experiments.

How can researchers investigate potential interactions between odr4 and G-protein coupled receptors (GPCRs)?

Investigating interactions between Xenopus laevis odr4 and G-protein coupled receptors (GPCRs) requires multiple complementary approaches, given the established role of mammalian RTPs in regulating GPCR trafficking and function:

Biochemical Interaction Assays:

  • Co-immunoprecipitation experiments:

    • Express epitope-tagged odr4 and candidate GPCRs in Xenopus oocytes or cell lines

    • Immunoprecipitate using antibodies against either protein

    • Analyze precipitates by Western blotting to detect co-precipitation

  • Proximity-based assays:

    • Bioluminescence Resonance Energy Transfer (BRET) between odr4 and GPCRs

    • Förster Resonance Energy Transfer (FRET) using fluorescently-tagged proteins

    • Split-luciferase complementation assays to detect direct interactions

Functional Assays:

  • Cell surface expression analysis:

    • Measure GPCR surface levels with and without odr4 co-expression

    • Use cell-impermeant biotinylation followed by streptavidin pull-down

    • Quantify using flow cytometry with antibodies against extracellular GPCR epitopes

  • GPCR signaling assays:

    • Measure GPCR-mediated calcium flux using fluorescent indicators

    • Assess cAMP production using FRET-based sensors

    • Evaluate β-arrestin recruitment in response to GPCR activation

Xenopus Oocyte Expression System:

The Xenopus oocyte expression system offers particular advantages for studying odr4-GPCR interactions:

  • Large cell size facilitates microinjection of multiple cRNAs

  • Established system for electrophysiological recording of GPCR-activated channels

  • Native cellular environment for amphibian proteins

Imaging Approaches:

  • Co-localization studies using confocal microscopy

  • Single-molecule tracking to analyze dynamics of GPCR trafficking

  • Super-resolution microscopy to examine nanoscale organization at the plasma membrane

These methodologies can reveal whether odr4 in Xenopus functions similarly to mammalian RTPs in regulating GPCR trafficking and activity, potentially revealing evolutionary conservation or divergence of these mechanisms.

What challenges must be addressed when studying odr4 in the tetraploid Xenopus laevis genome?

Studying odr4 in the tetraploid Xenopus laevis genome presents several significant challenges that require specific methodological approaches:

Genomic Complexity Challenges:

  • Allotetraploidy: X. laevis underwent whole-genome duplication, resulting in two distinct subgenomes (L and S)

  • Gene duplications: Many genes, potentially including odr4, exist as homeologous pairs with varying degrees of functional redundancy

  • Sequence divergence: Homeologous gene pairs may have undergone subfunctionalization or neofunctionalization

Experimental Solutions:

  • Comprehensive paralog identification:

    • Employ bioinformatic approaches to identify all odr4 paralogs

    • Analyze expression patterns of each paralog across tissues and developmental stages

    • Determine sequence conservation at nucleotide and protein levels

  • Paralog-specific targeting:

    • Design morpholinos that target specific paralogs or common sequences

    • Create CRISPR guide RNAs with paralog specificity or that target all paralogs

    • Develop paralog-specific antibodies and mRNA probes

  • Functional redundancy assessment:

    • Perform individual and combined knockdown/knockout of paralogs

    • Compare phenotypes from single versus combined manipulations

    • Conduct rescue experiments with individual paralogs

  • Alternative model considerations:

    • Use Xenopus tropicalis (diploid) for initial genetic studies

    • Validate key findings in X. laevis to assess conservation

    • Leverage the strengths of each model (genetic tractability in X. tropicalis, larger size and established protocols in X. laevis)

The tetraploid nature of X. laevis, while challenging, offers unique opportunities to study subfunctionalization and neofunctionalization of duplicated genes, potentially revealing insights into protein evolution that would not be accessible in diploid models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.