Recombinant Xenopus laevis Protein tweety homolog 1-A (ttyh1-a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant ttyh1-a

Recombinant Xenopus laevis Protein Tweety Homolog 1-A (ttyh1-a) is a bioengineered protein derived from the African clawed frog (Xenopus laevis), expressed in E. coli and purified with an N-terminal His tag. This protein is a member of the Tweety family, which encodes large-conductance chloride channels involved in cellular processes such as ion transport, mitosis, and neural stem cell (NSC) regulation .

Gene and Protein Structure

Gene Information

  • Gene Name: ttyh1-a

  • Synonyms: ttyh1-a, Protein Tweety Homolog 1-A

  • UniProt ID: Q6AX57

  • Species: Xenopus laevis (allotetraploid; contains homeologous pairs ttyh1.s and ttyh1.l) .

Expression and Purification

  • Expressed in E. coli using a His-tagged construct for affinity chromatography .

  • Lyophilized powder format for enhanced stability.

Ttyh1 vs. Prominin 1

FeatureTtyh1 (X. laevis)Prominin 1 (Human)
EV MorphologyTubulated, protein-richSpherical, stabilized by cholesterol
Cholesterol InteractionWeakStrong (CRAC/CARC motifs)
Biological RoleNSC quiescence, calcium regulationPhotoreceptor membrane homeostasis

Research Challenges and Future Directions

  • Evolutionary Conservation:

    • Xenopus ttyh1-a shares functional homology with mammalian Ttyh1 but lacks conserved CRAC/CARC motifs .

  • Pathway Interactions:

    • Elucidating cross-talk between Ttyh1 and Notch/calcium pathways in Xenopus development .

  • Disease Models:

    • Potential use in studying retinal dystrophies or neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ttyh1-a; Protein tweety homolog 1-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
ttyh1-a
Target Protein Sequence
MSTSHGYRASWWTNILHQVPHTNFQFEVVDNQFAPQEWPYQQALLFLASIAGLCLAISLI LICVYLIRFCCCASQEDDDSKNHRVCCVTWSCVAAVIICCAGIGIGFYGNSETNDGVYQV TYSLMNTNHTLTSINLLVSDTVELLSSVVKSDLTQLEEIFSKRTEFLVMIRNTRRQVESV AQQLAEISFWKGTELNPNVLAEQVNFIEDYRWLAYILLLLLDLIICLFTLLGLAKRIKWL VIVMTVVSFFVLLLSWGSMGLEMATAVGLSDFCSNPDGYVMNQTQMITNINPDILQYYIS CNQDVANPFRQRLTTSQRALSNIHSQLHGLEREAVPQFPTAEKNLLAVQGMLNTTEGNFH HLVALLNCRGLHKDYVDALKGLCYDGMEGILFLLLFSFLSALSFTAAVCSLPRAWKRFQN RDLDYDDMDEDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function
Probable chloride channel.
Database Links

KEGG: xla:447239

UniGene: Xl.11254

Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What oligomeric states does ttyh1-a form, and how are they regulated?

Based on insights from studies of the related TTYH2 protein, Tweety homolog proteins appear capable of forming different oligomeric states depending on conditions. TTYH2 has been observed to form both cis-dimers (within the same membrane) and, unexpectedly, trans-dimers that bridge two opposing membranes through interactions between the extracellular domains. Ca²⁺ concentration appears to play a regulatory role in these oligomeric transitions. In Ca²⁺-free conditions, TTYH2 exists in approximately equal proportions as monomers and trans-dimers .

While these specific findings are for TTYH2, the high conservation within the tweety family suggests ttyh1-a may exhibit similar oligomerization behavior, potentially important for its functions in cell-cell interactions during development and disease processes.

How is ttyh1-a evolutionarily conserved across species?

The tweety gene family, including ttyh1-a, displays remarkable evolutionary conservation. Tweety-like genes are found in organisms ranging from simple unicellular eukaryotes to complex vertebrates, indicating a deep evolutionary origin. These genes encode chloride channels found in animals, plants, and even simple eukaryotes like Salpingoeca rosetta (choanoflagellate), Ostreococcus tauri (chlorophyte), and Sphaeroforma arctica (unicellular eukaryote) .

In vertebrates, the tweety gene family consists of three highly conserved members: ttyh1, ttyh2, and ttyh3. The conservation pattern suggests essential functional roles that have been maintained throughout evolution. Xenopus laevis, being an allotetraploid, has homeologous pairs for ttyh1 (ttyh1.s encoding Ttyh1b, and ttyh1.l encoding Ttyh1a) and ttyh3 (ttyh3.s and ttyh3.l), unlike its close relative Xenopus tropicalis, which is diploid and lacks these pairs .

What is the expression pattern of ttyh1-a during embryonic development?

The expression pattern of ttyh1-a during Xenopus laevis embryonic development shows dynamic regulation. According to RNA-Seq data, ttyh1.s (encoding Ttyh1b) is expressed in fertilized eggs but decreases during cleavage through blastula stages. While in situ hybridization (ISH) could not detect signal at pre-gastrulation stages, more sensitive qRT-PCR revealed low levels of tweety family gene expression through blastula stages with slightly elevated levels near the mid-blastula transition for ttyh1, before dropping back to basal levels .

This contrasts with the related species Xenopus tropicalis, where RNA-Seq data shows very low levels of ttyh1 during cleavage stages. The differences in expression patterns between the tweety family members (ttyh1, ttyh2, and ttyh3) during early development suggest specific temporal regulation and potentially distinct roles during embryogenesis .

How do the homeologous pairs of ttyh1 in Xenopus laevis differ functionally?

Xenopus laevis, as an allotetraploid organism, possesses homeologous pairs for the ttyh1 gene: ttyh1.s (encoding Ttyh1b) and ttyh1.l (encoding Ttyh1a). While both encode Protein tweety homolog 1 variants, their expression patterns differ during development, suggesting potential subfunctionalization or neofunctionalization. The ttyh1.s gene shows expression in fertilized eggs that decreases during cleavage and blastula stages, while the complete expression profile of ttyh1.l throughout development is less characterized in the available literature .

This divergence in expression patterns between homeologs likely reflects evolutionary adaptation following genome duplication in Xenopus laevis, potentially contributing to specialized functions in different developmental contexts or tissues. Research comparing the functional properties of Ttyh1a and Ttyh1b would be valuable for understanding how gene duplication events contribute to protein functional diversification.

What is the role of ttyh1-a in neural development?

The ttyh1-a protein plays significant roles in neural development, particularly in neural stem cell maintenance, proliferation, and filopodia formation. As a member of the tweety gene family that encodes gated chloride channels, ttyh1-a contributes to the regulation of cell volume, which is critical during neuronal development and differentiation .

Research suggests that ttyh1-a's function in filopodia formation is particularly important for neuronal process extension and potentially synaptic development. These cellular protrusions are essential for axon pathfinding, dendritic branching, and the formation of neural networks during development. The protein's expression pattern during embryonic and fetal development further supports its role in neural tissue formation and maturation .

How does ttyh1-a contribute to tumor progression in gliomas?

Ttyh1 has been identified as a potent driver of tumor microtube (TM)-mediated brain colonization by glioma cells. These tumor microtubes are invasive membrane protrusions that enable glioma cells to colonize brain tissue effectively. Research has demonstrated that targeting Ttyh1 inhibits the formation of invasive TMs and reduces glioma growth, highlighting its potential as a therapeutic target .

Interestingly, while Ttyh1 inhibition reduced invasive TMs and glioma growth, it increased network formation by intercellular TMs. This suggests a functional and molecular heterogeneity of tumor microtubes, with potential implications for developing effective TM-targeting strategies in glioma treatment. This dual effect indicates a complex role for Ttyh1 in tumor cell behavior that requires careful consideration when developing therapeutic approaches .

What are the ion channel properties of ttyh1-a and how do they relate to its cellular functions?

The tweety gene family, including ttyh1-a, encodes gated chloride channels that play important roles in cell volume regulation. While the specific electrophysiological properties of Xenopus laevis ttyh1-a have not been fully characterized in the provided search results, related tweety homolog proteins are known to form Ca²⁺- and cell volume-regulated anion channels structurally distinct from other characterized channel families .

These channels likely contribute to ionic homeostasis during various cellular processes, including cell division, migration, and morphological changes during development. The regulation of chloride flux across membranes is particularly important in neuronal function, potentially explaining ttyh1-a's prominent role in neural development and its dysregulation in neurological diseases and cancers like glioma .

What are the optimal conditions for storing and handling recombinant ttyh1-a protein?

For optimal storage and handling of recombinant Xenopus laevis Protein tweety homolog 1-A (ttyh1-a), the following conditions are recommended:

Storage conditions:

  • Store at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles

  • Store working aliquots at 4°C for up to one week

Buffer composition:

  • Tris-based buffer containing 50% glycerol, optimized for this specific protein

When working with the protein, it's important to maintain its native conformation by avoiding temperature fluctuations and ensuring buffer conditions remain stable. The high glycerol content (50%) in the storage buffer helps prevent protein denaturation during freeze-thaw cycles, but minimizing such cycles is still recommended for optimal protein activity and stability .

What experimental approaches can be used to study ttyh1-a oligomerization and membrane topology?

Based on studies of related tweety homolog proteins, several experimental approaches can be employed to investigate ttyh1-a oligomerization and membrane topology:

For membrane topology determination:

  • Immunocytochemistry with epitope-tagged constructs: Express ttyh1-a with tags at different termini (e.g., GFP-tagged C-terminus) in cell lines like HEK293T cells, then use antibodies against the N-terminus and the C-terminal tag to determine their cellular localization without membrane permeabilization (for extracellular epitopes) and with permeabilization (for intracellular epitopes) .

  • Cysteine accessibility methods: Introduce cysteine residues at various positions and test their accessibility to membrane-impermeable sulfhydryl reagents to map extracellular versus intracellular domains.

For oligomerization studies:

  • Cryo-electron microscopy (cryo-EM): Purify the protein and reconstitute it into lipid nanodiscs for structural determination under different conditions (e.g., varying Ca²⁺ concentrations) .

  • Crosslinking studies: Use chemical crosslinkers of varying lengths to identify interacting regions between protein subunits.

  • FRET (Förster Resonance Energy Transfer): Tag different populations of ttyh1-a with appropriate fluorophores to detect close associations indicative of oligomerization in living cells .

These approaches can help resolve contradictions between computational predictions and actual protein topology, as demonstrated by Han et al. (2019) for murine Ttyh1 .

What expression systems are most effective for producing functional recombinant ttyh1-a for structural studies?

While the search results don't specifically address expression systems for ttyh1-a, information about related tweety homolog proteins suggests several effective approaches:

Eukaryotic expression systems:
For functional studies requiring proper folding and post-translational modifications, eukaryotic expression systems may be preferable:

  • Mammalian cell lines: HEK293T cells have been successfully used for expressing tweety family proteins for functional and localization studies .

  • Insect cells: Baculovirus-infected Sf9 or Hi5 insect cells often provide high yields of properly folded membrane proteins.

For structural studies specifically, expression optimization strategies include:

  • Using fusion partners to improve solubility and expression

  • Screening multiple constructs with varying N- and C-terminal boundaries

  • Testing different detergents for protein extraction and purification

  • Reconstituting the purified protein into nanodiscs or other membrane mimetics for cryo-EM studies

The choice of expression system should be guided by the specific experimental requirements, with eukaryotic systems generally preferred for functional studies of membrane proteins like ttyh1-a.

How is ttyh1-a being investigated as a potential therapeutic target in gliomas?

Current investigative approaches include:

  • Genetic knockdown studies: Using siRNA or CRISPR-Cas9 to reduce Ttyh1 expression and evaluate effects on glioma cell invasion, proliferation, and survival.

  • Functional assays: Assessing how Ttyh1 modulation affects glioma cell migration, invasion capacity, and tumor microtube formation.

  • Development of specific inhibitors: Designing small molecules or antibodies that selectively target Ttyh1 function in invasive tumor microtubes while minimizing effects on intercellular TMs.

These investigations aim to elucidate the molecular mechanisms by which Ttyh1 promotes glioma progression and to develop targeted therapeutic strategies that could potentially improve outcomes for glioma patients .

What is the relationship between ttyh1-a and neurodevelopmental disorders?

While the search results don't directly address ttyh1-a's relationship with neurodevelopmental disorders, the protein's significant role in neural stem cell maintenance, proliferation, and filopodia formation during neural development suggests potential implications for such conditions .

The tweety gene family has been implicated in various neurological pathologies, including neurodegenerative diseases such as Alzheimer's and Parkinson's disease. Given ttyh1-a's functions in neural development, alterations in its expression or function could potentially contribute to neurodevelopmental disorders characterized by abnormal neural connectivity or neuronal migration .

How can comparative studies of ttyh1-a across different species inform our understanding of its functions?

Comparative studies of ttyh1-a across different species can provide valuable insights into its evolutionary conservation and functional importance. The tweety gene family's presence in organisms ranging from simple unicellular eukaryotes to complex vertebrates indicates essential conserved functions .

Such comparative approaches can:

  • Identify conserved functional domains: Sequence alignment across species can reveal highly conserved regions likely crucial for the protein's function, guiding targeted mutagenesis studies.

  • Illuminate functional adaptations: Species-specific variations may highlight adaptive changes that correlate with specialized functions in different organisms or tissues.

  • Provide developmental context: Comparing expression patterns during embryogenesis across species can reveal conserved developmental roles and species-specific adaptations.

  • Inform disease models: Understanding how ttyh1-a functions in model organisms like Xenopus can inform the selection of appropriate disease models for studying ttyh1-related pathologies in humans.

The allotetraploidy of Xenopus laevis provides a unique opportunity to study subfunctionalization between homeologous pairs (ttyh1.s and ttyh1.l), offering insights into how gene duplication events contribute to functional diversification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.