Recombinant Xenopus laevis Protein tweety homolog 1-B (ttyh1-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ttyh1-b; Protein tweety homolog 1-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
ttyh1-b
Target Protein Sequence
MSTSHGYRASWWTYILHQVPHTNFQFEVVDNQFAPQEWSYQQALLFLASIAGLCLAISLV LICVYLIKFCCCASQEDDDSKSHRVCCVTWSCVAAVIICCAGIGIGFYGNSETNDGVYQV TYSLMNANHTLTSINLLVSDTVELLSSVVKSDLTQLEEIFSTRTEFVVMIRNTRRQVESV AQQLTEISSFFWKGAELNPSALAEQVNFIEDYRWLAYILLLLLDLIICLFTLLSLAKQIK WLVIVMTVVSFFVLLLSWGSMGLEMATAVGLSDFCSDPDAYVMNQTQMITNINPDILQYY ISCNQDVTNPFRQRLTMSQRALSNIHSQLHGLEREAVPQFPTAERNVLVVQGMLNTTEGN FHHLVALLNCRGLHKDYVDALKGLCYDGMEGILFLLLFSFLSALSFTAAVCSLPRAWKRF RNRDLDYDDMDEDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function
Probable chloride channel.
Database Links

KEGG: xla:444603

UniGene: Xl.47331

Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the tweety homolog 1-B (ttyh1-b) protein in Xenopus laevis?

Tweety homolog 1-B (ttyh1-b) is a member of the tweety gene family that encodes large-conductance chloride channels in Xenopus laevis. This protein family has been implicated in various cellular processes including cell division, cell adhesion, regulation of calcium activity, and tumorigenesis, particularly in neuronal cells . The ttyh1-b protein consists of 451 amino acids and functions as part of a family of genes that plays significant roles in embryonic development of the nervous system. The recombinant form can be produced with an N-terminal His tag expressed in E. coli expression systems . The temporal and spatial expression patterns of ttyh1 suggest it has distinct developmental roles compared to other tweety homologs (ttyh2 and ttyh3) .

How is ttyh1 expressed during Xenopus embryonic development?

The expression of ttyh1 during Xenopus laevis embryonic development follows a specific temporal and spatial pattern:

  • Initial expression is first detected at the late neurula stage, primarily localized to the developing nervous system .

  • By late neurula stages (stage 19), ttyh1 transcripts become particularly abundant in the midbrain in the presumptive eye region .

  • During tailbud stages, mRNA levels increase throughout the nervous system following an anterior (strongest signal) to posterior (weaker signal) gradient, with distinct transient expression also observed in the somites .

  • At swimming tadpole stages, expression increases dramatically and extends to the posterior end of the spinal cord .

  • Throughout development, ttyh1 remains restricted to proliferative, ventricular zones, which differs from the expression pattern of ttyh3 that is primarily localized to postmitotic regions of the developing nervous system .

The onset and timing of ttyh1 expression coincides approximately with the timing of neurite formation in Xenopus, suggesting a potential role in this process . When designing developmental studies, researchers should consider these stage-specific expression patterns to properly target their investigations.

How do the expression patterns of tweety homologs differ in Xenopus?

The three tweety homologs (ttyh1, ttyh2, and ttyh3) exhibit distinct spatial and temporal expression patterns during Xenopus development, suggesting they may play different roles:

HomologPrimary Expression LocationsTemporal PatternKey Characteristics
ttyh1- Developing central nervous system
- Proliferative ventricular zones
- Transient expression in somites
First detected at neurula stages- Follows anterior to posterior gradient
- Associated with neuritogenesis
ttyh2- Cranial ganglia V, VII, IX and X
- Nearly exclusive to cranial ganglia initially
Later than ttyh1- Implicated in tumorigenesis
- Different expression pattern than ttyh1
ttyh3- Postmitotic regions of nervous system
- Transient expression in somites
Similar to ttyh1- Expressed in nearly mutually exclusive manner to ttyh1
- Weaker and broader expression than ttyh1

This differential expression suggests specialized functions for each homolog during nervous system development. When designing experiments to target a specific tweety homolog, researchers should carefully consider probe specificity, as sequence similarity could lead to cross-hybridization if experimental conditions are not optimized .

What are the optimal conditions for reconstitution and storage of recombinant ttyh1-b?

For optimal handling of recombinant ttyh1-b protein, the following methodological approach is recommended:

  • Initial handling: Briefly centrifuge the vial prior to opening to bring contents to the bottom of the tube .

  • Reconstitution protocol:

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

    • Mix gently until completely dissolved

  • Storage recommendations:

    • For long-term storage: Aliquot and store at -20°C/-80°C

    • For working stocks: Store aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • Buffer conditions: The protein is supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Quality control: Confirm protein integrity after reconstitution using SDS-PAGE, with expected purity greater than 90%

This methodological approach ensures maximum protein stability and activity for experimental applications. When planning experiments, researchers should prepare only the amount needed for immediate use and maintain proper temperature conditions throughout handling.

How can ttyh1-b be studied in the context of neurological development?

To effectively study ttyh1-b in neurological development contexts, researchers can employ several methodological approaches:

  • Expression analysis techniques:

    • Whole mount in situ hybridization (ISH) to visualize spatial expression patterns during different developmental stages

    • Fluorescent ISH for co-localization studies with other neural markers

    • Quantitative RT-PCR for precise temporal expression profiling

  • Functional studies:

    • Morpholino-mediated knockdown to assess loss-of-function phenotypes

    • CRISPR/Cas9 gene editing for targeted mutations

    • Overexpression studies using mRNA injection at early developmental stages

  • Specific neural development applications:

    • Investigate ttyh1's role in neurite formation, as its expression coincides with neuritogenesis in Xenopus

    • Examine potential functions in proliferative zones, as ttyh1 is restricted to ventricular zones of the developing nervous system

    • Study the relationship between ttyh1 and developmental chloride channel activity

  • Comparative approaches:

    • Design experiments that compare ttyh1, ttyh2, and ttyh3 functions, leveraging their different expression patterns (e.g., ttyh1 in proliferative zones versus ttyh3 in postmitotic regions)

    • Cross-species comparisons with mouse models, where ttyh1 has also been shown to play essential roles during embryogenesis

When conducting these studies, researchers should carefully select developmental stages based on the known expression timeline, with initial expression at neurula stages and increased expression during swimming tadpole stages .

What is the relationship between ttyh1 and tumor microtubes in glioma research?

Recent research has revealed a significant relationship between ttyh1 and tumor microtubes (TMs) in glioma biology, offering important insights for cancer researchers:

  • Functional relationship:

    • Ttyh1 has been identified as a potent regulator of tumor microtube (TM) morphology

    • It drives TM-mediated tumor-cell invasion and proliferation in gliomas

    • Ttyh1 particularly affects glioma cells with one or two TMs, which are primarily responsible for effective brain colonization

  • Experimental evidence:

    • Correlative gene-expression microarray and in vivo imaging analyses identified ttyh1 as one of the highest-scoring genes related to the outgrowth of TMs

    • Ttyh1 was found to be highly expressed in a fraction of TMs in both mouse models and human patients

    • Downregulation of Ttyh1 resulted in reduced tumor progression and prolonged survival in mouse models

  • Molecular heterogeneity findings:

    • Research suggests cellular and molecular heterogeneity in gliomas regarding the formation and function of distinct TM subtypes

    • Ttyh1-deficient tumor cells showed an increase in interconnecting TMs, which was associated with increased radioresistance in small tumors

    • These findings suggest different TM subtypes may have distinct molecular profiles and functions

  • Developmental parallels:

    • The role of Ttyh1 in TMs shows multiple parallels to its functions in neuronal development

    • This connection between developmental and pathological processes provides potential insights into the mechanisms of glioma progression

This relationship positions Ttyh1 as a promising target for reducing TM-associated brain colonization by glioma cells. Researchers investigating this area should consider the dual-edged nature of Ttyh1 targeting, as its inhibition may simultaneously reduce invasive TMs while potentially increasing network formation by intercellular TMs .

What methods are most effective for analyzing ttyh1 expression patterns in developmental studies?

For robust analysis of ttyh1 expression patterns in developmental studies, researchers should consider the following methodological approaches:

  • Whole mount in situ hybridization (WISH):

    • Effective for spatial expression analysis during early embryonic development

    • Can be performed using BCIP/NBT (nitroblue tetrazolium/5-bromo-4-chloro-3-indolylphosphate) alkaline phosphatase substrates

    • Requires careful probe design to avoid cross-hybridization with other tweety family members

  • Double fluorescent in situ hybridization:

    • Critical for co-localization studies with other developmental markers

    • Can be performed using tyramide signal amplification (TSA) with Cy3-tyramide and FITC-tyramide for dual detection

    • Enables precise cellular localization of ttyh1 expression relative to other markers

  • Histological sectioning:

    • Provides detailed analysis of expression in specific tissues

    • Transverse 25μm sections along the anterior-posterior axis are recommended for neural tissue examination

    • Crucial for distinguishing between ventricular (proliferative) versus postmitotic expression domains

  • Quantitative expression analysis:

    • Quantitative RT-PCR provides precise temporal expression data

    • Important for resolving potential discrepancies between visual ISH results and actual transcript levels

    • Can detect splice variants known to occur in the tweety gene family

  • Controls and validation:

    • Always include sense probes to verify absence of nonspecific binding

    • Pairwise sequence comparisons between tweety homologs to ensure probe specificity (ideally <25% identity between homologs)

    • Multiple detection methods should be used to confirm expression patterns

When applying these methods, researchers should pay particular attention to the developmental timing, as ttyh1 expression begins at neurula stages and increases significantly at swimming tadpole stages .

How can gene editing tools be used to study ttyh1-b function in Xenopus models?

To effectively investigate ttyh1-b function in Xenopus models using gene editing tools, researchers can implement the following methodological approach:

  • CRISPR/Cas9-mediated gene editing:

    • Design guide RNAs (gRNAs) targeting conserved functional domains of ttyh1-b

    • Inject Cas9 protein and gRNAs into Xenopus embryos at the one-cell stage for complete knockout or at later stages for mosaic analysis

    • Verify editing efficiency using T7 endonuclease assays or direct sequencing

    • Analyze phenotypes at key developmental stages, particularly during neurulation and nervous system development

  • Morpholino antisense oligonucleotides:

    • Design translation-blocking or splice-blocking morpholinos specific to ttyh1-b

    • Inject morpholinos at early cleavage stages

    • Include control morpholinos and rescue experiments using morpholino-resistant ttyh1-b mRNA

    • Monitor phenotypic changes in the developing nervous system, focusing on proliferative zones where ttyh1 is predominantly expressed

  • Transgenic approaches:

    • Generate tissue-specific or inducible ttyh1-b expression constructs

    • Use the Tol2 transposon system for efficient genomic integration

    • Develop reporter lines expressing fluorescent proteins under ttyh1-b promoter control to visualize real-time expression

    • Implement Cre-loxP systems for conditional knockouts in specific tissues

  • Functional assays following genetic manipulation:

    • Analyze neural progenitor proliferation and differentiation

    • Assess neurite formation and outgrowth, particularly during stages coinciding with endogenous ttyh1 expression

    • Measure chloride channel activity using electrophysiological techniques

    • Investigate changes in calcium regulation, as tweety family proteins have been implicated in calcium activity regulation

  • Comparative analysis:

    • Perform parallel manipulations of other tweety family members (ttyh2, ttyh3) to distinguish unique versus redundant functions

    • Compare phenotypes to mammalian models to identify evolutionarily conserved functions

When designing these experiments, researchers should consider the temporal expression pattern of ttyh1-b, ensuring genetic manipulations are performed at appropriate developmental stages to capture relevant phenotypes.

What approaches can resolve discrepancies between different ttyh1 expression detection methods?

Resolving discrepancies between different ttyh1 expression detection methods requires a systematic approach that combines multiple techniques and careful experimental design:

  • Integrated multi-method approach:

    • Combine in situ hybridization (ISH), qRT-PCR, and protein-level detection methods

    • Compare results across techniques to identify consistent patterns versus technique-specific artifacts

    • When discrepancies are observed (as noted with ttyh3 in Xenopus studies), extend color reaction times for ISH or use more sensitive detection methods

  • Splice variant analysis:

    • Design experiments to detect potential splice variants of ttyh1

    • Use primers spanning different exon junctions for RT-PCR

    • Implement RNA-seq to identify all expressed transcripts

    • Consider that some detection methods may preferentially detect certain variants

  • Probe and primer design considerations:

    • Design multiple probes targeting different regions of ttyh1 mRNA

    • Ensure high specificity through careful sequence analysis (less than 25% identity with other tweety homologs)

    • Use control probes in parallel experiments

    • Validate qRT-PCR primers using standard curves and melt curve analysis

  • Tissue-specific and subcellular localization:

    • Implement single-cell RNA-seq to resolve cell-type specific expression patterns

    • Use fluorescent in situ hybridization combined with immunohistochemistry for co-localization studies

    • Consider subcellular mRNA localization, which can affect detection efficiency

    • Perform histological sectioning to improve signal detection in dense tissues

  • Quantification and normalization:

    • Apply consistent quantification methods across experiments

    • Use multiple reference genes for qRT-PCR normalization

    • Implement appropriate statistical analyses to determine significance of apparent differences

    • Consider absolute quantification methods when relative methods show inconsistencies

By systematically addressing these factors, researchers can better understand the true expression patterns of ttyh1 and resolve apparent discrepancies between detection methods reported in the literature .

How does the function of ttyh1-b in Xenopus compare to mammalian systems?

The functional comparison of ttyh1-b between Xenopus and mammalian systems reveals important evolutionary conservation and divergence:

  • Developmental expression patterns:

    • In both Xenopus and mice, ttyh1 is expressed in the developing brain during embryogenesis

    • Mouse studies have demonstrated ttyh1 expression in the E7.5 and E14.5 brain, showing its essential role during mammalian embryogenesis

    • In Xenopus, ttyh1 is restricted to proliferative ventricular zones, while in mammals it shows broader expression in developing neural tissues

  • Neuronal development functions:

    • Across species, ttyh1 is associated with neurite outgrowth and dynamic filipodia-like protrusions

    • In rat cell cultures and brain slices, ttyh1 has been linked to neuritogenesis

    • The onset and timing of ttyh1 expression in Xenopus coincides with neurite formation, suggesting functional conservation in this aspect of neural development

  • Pathological implications:

    • In mammalian systems, ttyh1 has been identified as a driver of tumor microtube (TM) formation in gliomas

    • Ttyh1 regulates TM-mediated tumor cell invasion and proliferation in mammalian brain tumor models

    • The developmental function of ttyh1 appears to be co-opted in mammalian brain tumors, suggesting evolutionary conservation of its core cellular functions

  • Molecular structure and interactions:

    • The tweety family shows evolutionary relationships where ttyh1 and ttyh2 share more similarity at the amino acid and predicted protein level compared to ttyh3

    • Ttyh3 has a different transmembrane structure, suggesting functional divergence

    • Evolutionary analysis indicates ttyh3 homologs diverged prior to a duplication event that led to ttyh1 and ttyh2 genes

  • Experimental considerations for cross-species studies:

    • When translating findings between species, researchers should account for potential differences in regulation and interacting partners

    • The high conservation of key functional domains suggests that mechanistic insights from Xenopus studies may be applicable to mammalian systems

    • Xenopus offers advantages for developmental studies due to the ability to access and manipulate all stages of development

This comparative understanding provides a foundation for translating basic developmental findings from Xenopus models to potential therapeutic applications in human pathologies involving ttyh1 dysfunction .

What are the most promising applications of ttyh1-b research?

Based on current knowledge, several promising research directions for ttyh1-b emerge:

  • The developmental role of ttyh1-b in the nervous system makes it a valuable model for studying neurogenesis, particularly in proliferative zones where it is predominantly expressed . Future studies could elucidate mechanisms controlling neural progenitor proliferation versus differentiation.

  • The critical involvement of ttyh1 in tumor microtubes (TMs) suggests potential therapeutic applications in glioma treatment . Targeting ttyh1 might reduce TM-mediated brain colonization by glioma cells, though careful consideration must be given to the potential increase in interconnecting TMs that could enhance radioresistance.

  • As a large-conductance chloride channel, ttyh1-b offers opportunities to study ion channel regulation during development . Its specific expression pattern could provide insights into how ion channel activity influences neural circuit formation.

  • The parallels between ttyh1's developmental functions and its role in pathological processes highlight the value of comparative developmental-pathological studies . Such research may reveal how normal developmental mechanisms are co-opted during disease progression.

  • The distinct expression patterns of tweety family members (ttyh1, ttyh2, ttyh3) present an excellent model for studying gene duplication and functional divergence . Further research could illuminate how these related genes evolved specialized functions in vertebrate development.

These research directions reflect the multifaceted nature of ttyh1-b and its potential significance across developmental biology, neuroscience, and cancer research. Integration of findings across these fields will be essential for fully understanding this protein's biological significance .

What methodological challenges remain in ttyh1-b research?

Despite significant advances, several methodological challenges persist in ttyh1-b research:

  • Distinguishing the specific functions of ttyh1-b from other tweety homologs remains difficult due to potential functional redundancy. Developing approaches that can selectively target ttyh1-b without affecting related family members is essential for precise functional characterization .

  • The potential existence of multiple splice variants complicates expression analysis and functional studies. Comprehensive transcriptomic approaches are needed to catalog all variants and determine their specific expression patterns and functions .

  • As a membrane protein, structural studies of ttyh1-b present significant technical challenges. Developing methods for high-resolution structural analysis of membrane proteins in their native environment would advance understanding of ttyh1-b's channel functions.

  • The temporal dynamics of ttyh1-b expression during development require sophisticated time-resolved approaches. Implementation of live imaging techniques with fluorescent reporters under endogenous regulatory elements could overcome this challenge .

  • Translating findings from Xenopus to mammalian systems, especially regarding therapeutic applications in glioma treatment, remains challenging. Developing better cross-species models that account for species-specific differences will be crucial for advancing translational research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.