Recombinant Xenopus laevis Protein YIF1B-A (yif1b-a)

Shipped with Ice Packs
In Stock

Description

Biological Function

YIF1B-A plays a pivotal role in intracellular trafficking:

  • ER-to-Plasma Membrane Trafficking: Facilitates anterograde transport of cargo proteins, including neurotransmitter receptors .

  • Golgi Organization: Maintains Golgi architecture by regulating vesicle fusion and fission dynamics .

  • Neuronal Specificity: Demonstrated in mammalian studies to mediate dendritic targeting of 5-HT1A serotonin receptors, suggesting conserved functionality in Xenopus homologs .

Production and Quality Control

Expression Systems:

ParameterDetails
Host OrganismsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (lot-specific, verified by SDS-PAGE)
StorageLyophilized or liquid; stable at -20°C/-80°C (avoid repeated freeze-thaw cycles)

Validation Methods:

  • Western blotting with anti-Yif1B antibodies .

  • Functional assays assessing vesicular trafficking in transfected cells .

Research Applications

  • Mechanistic Studies: Used to investigate ER/Golgi trafficking pathways and receptor localization .

  • Drug Development: Serves as a target for antidepressants by modulating serotonin receptor trafficking .

  • Comparative Biology: Provides insights into evolutionary conservation of trafficking machinery across species .

Key Research Findings

  • Interaction with 5-HT1AR: YIF1B-A binds to the C-terminal domain of serotonin receptors, enabling dendritic targeting in neurons .

  • siRNA Knockdown Effects: Silencing Yif1B disrupts 5-HT1AR localization without affecting other receptors (e.g., sst2A, P2X2) .

  • Evolutionary Significance: Retains 95% sequence similarity in zinc-finger domains with mammalian YY1 proteins, underscoring functional conservation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
yif1b-a; Protein YIF1B-A; YIP1-interacting factor homolog B-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
yif1b-a
Target Protein Sequence
MNQESSFRAPPKRRARGSNPNVSTPHQLFDDTSGGPVPHGGEYPNHSSPALGIPAQAFLS EPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQ DWEVRYQQDTPVAPRFDINAPDLYIPVMAFVTYILVAGLALGTQSRFSPEILGMQASSAL AWLIVEVLAILLSLYLVTVNTDLTTVDLVAFTGYKYVGMISGVISGLLFGKTGYYIVLAW CCISIVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLVR
Uniprot No.

Target Background

Function
YIF1B-A plays a crucial role in the anterograde trafficking pathway from the endoplasmic reticulum to the plasma membrane and the organization of Golgi architecture.
Database Links

KEGG: xla:443676

UniGene: Xl.6144

Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is YIF1B-A and what is its basic structure in Xenopus laevis?

YIF1B-A in Xenopus laevis is a homolog of the mammalian YIF1B protein, which is well-conserved across species with approximately 76% identity to the rat YIF1B protein . The mammalian YIF1B contains five transmembrane segments clustered in the C-terminal moiety, a long hydrophilic N-terminal domain within the cytoplasm, and a very short C-terminus turned toward the ER lumen . Based on conservation patterns, Xenopus YIF1B-A likely maintains this general structural organization.

To characterize the structure experimentally:

  • Use hydropathy plot analysis to confirm transmembrane domains

  • Perform epitope tagging experiments at N- and C-termini to verify topology

  • Consider using predictive software such as TMHMM2.0 for initial transmembrane segment identification

What is the cellular localization pattern of YIF1B-A in Xenopus cells?

Based on mammalian studies, YIF1B-A likely localizes to the early secretory pathway, particularly in ER-derived vesicles and intermediate compartments involved in ER-to-Golgi trafficking . In mammalian models, YIF1B has been observed in small vesicles involved in transient intracellular trafficking .

To determine localization in Xenopus cells:

  • Express fluorescently-tagged YIF1B-A in Xenopus cell lines or primary cultures

  • Perform co-localization studies with markers for ER (calnexin), ERGIC (ERGIC-53), and Golgi (GM130)

  • Use confocal microscopy with Z-stack imaging to capture the complete distribution pattern

How does YIF1B-A differ from YIF1B-B in Xenopus laevis?

While the search results don't specifically address YIF1B-A versus YIF1B-B in Xenopus, we can extrapolate from mammalian studies showing two closely related genes in the YIF1 family. In mammals, YIF1A and YIF1B display approximately 50% amino acid identity, with the greatest similarity occurring after the first 60 amino acids .

For experimental characterization of differences:

  • Perform sequence alignment analysis between YIF1B-A and YIF1B-B

  • Compare expression patterns using in situ hybridization

  • Conduct isoform-specific knockdown studies to assess differential functions

What are the recommended methods for recombinant expression of Xenopus YIF1B-A?

For effective recombinant expression of Xenopus YIF1B-A:

  • Expression system selection:

    • Bacterial systems (E. coli): Suitable for producing the soluble N-terminal domain

    • Eukaryotic systems (insect cells, mammalian cells): Preferred for full-length protein with proper folding and post-translational modifications

    • Xenopus oocytes: Ideal for functional studies in native-like environment

  • Construct design considerations:

    • Include appropriate purification tags (His, GST) preferably at the N-terminus

    • Consider codon optimization for the expression system

    • For membrane protein expression, fusion with GFP can help monitor expression and folding

  • Purification approach:

    • For full-length protein: Use detergent solubilization (mild non-ionic detergents like DDM)

    • For N-terminal domain: Standard affinity chromatography methods

What antibodies or detection methods are effective for studying Xenopus YIF1B-A?

Based on approaches used for mammalian YIF1B:

  • Antibody generation strategies:

    • Target the N-terminal cytoplasmic domain for highest specificity

    • In mammalian studies, researchers generated antibodies against the N-terminal peptide sequence 12TPRLRKWPSKRRV24

    • Consider using a conserved epitope that shows high identity between species

  • Validation methods:

    • Western blotting with recombinant protein as positive control

    • Immunofluorescence in cells with known overexpression or knockdown

    • Pre-absorption controls to confirm specificity

  • Alternative detection methods:

    • Epitope tagging (HA, FLAG, GFP) when antibodies are unavailable

    • RNA detection via in situ hybridization using specific probes

What are effective strategies for YIF1B-A knockdown or knockout in Xenopus experimental models?

For manipulating YIF1B-A expression in Xenopus models:

  • Morpholino antisense oligonucleotides:

    • Design translation-blocking or splice-blocking morpholinos

    • Inject at 1-2 cell stage for systemic knockdown

    • Include control morpholinos and rescue experiments with morpholino-resistant mRNA

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs targeting early exons

    • For F0 analysis, inject sgRNA and Cas9 protein into fertilized eggs

    • For stable lines, use primordial germ cell targeting approaches

  • siRNA approaches (for cell culture):

    • Based on mammalian studies, design double-stranded stealth RNAs targeting conserved regions

    • Mammalian studies used sequences targeting nucleotides 509-533 and 937-961 with appropriate controls

    • Test multiple siRNAs to confirm specificity of phenotypes

What is the role of YIF1B-A in protein trafficking in Xenopus cells?

Based on mammalian studies, YIF1B-A likely plays a crucial role in the ER-to-Golgi transport of specific cargo proteins:

  • Experimental approaches to study trafficking function:

    • Pulse-chase experiments with cargo proteins in the presence/absence of YIF1B-A

    • Live cell imaging with fluorescent cargo proteins

    • Secretion assays measuring transport kinetics of model proteins

  • Molecular mechanisms:

    • YIF1B appears to be involved in the selective trafficking of certain membrane proteins, as demonstrated by its role in 5-HT1AR dendritic targeting in mammals

    • The protein likely functions in concert with other trafficking machinery components in COPII vesicles

  • Cargo specificity:

    • In mammals, YIF1B shows specificity for 5-HT1AR but not for other receptors like sst2A, P2X2, and 5-HT3A receptors

    • Testing different candidate cargoes would help establish conservation of this specificity in Xenopus

How does YIF1B-A interact with G-protein coupled receptors in Xenopus models?

Mammalian YIF1B interacts specifically with the C-terminus of the 5-HT1A serotonin receptor to facilitate its dendritic targeting . For investigating similar interactions in Xenopus:

  • Interaction screening methods:

    • Yeast two-hybrid screening using YIF1B-A as bait against Xenopus cDNA libraries

    • GST pull-down assays with the C-terminal domains of candidate GPCRs

    • Co-immunoprecipitation studies from Xenopus tissues or cells

  • Mapping interaction domains:

    • Generate truncation mutants of YIF1B-A to identify binding regions

    • Use peptide arrays to map specific amino acid sequences involved

    • Perform site-directed mutagenesis of key residues

  • Functional validation:

    • Assess co-localization of YIF1B-A with candidate receptors in Xenopus cells

    • Determine if YIF1B-A knockdown affects trafficking of specific GPCRs

    • Perform rescue experiments with wild-type and mutant YIF1B-A

How is YIF1B-A expression regulated during Xenopus development?

To characterize the developmental regulation of YIF1B-A:

  • Expression analysis methods:

    • Quantitative RT-PCR across developmental stages

    • Whole-mount in situ hybridization to determine tissue-specific expression patterns

    • Immunohistochemistry to assess protein distribution if antibodies are available

  • Transcriptional regulation:

    • Promoter analysis to identify key regulatory elements

    • ChIP-seq to identify transcription factors binding to the YIF1B-A promoter

    • Reporter assays to validate regulatory elements

  • Functional significance during development:

    • Temporal knockdown experiments targeting specific developmental windows

    • Tissue-specific knockout using Cre-lox approaches in transgenic Xenopus

    • Correlate expression changes with developmental events requiring active membrane trafficking

How conserved is YIF1B-A function between Xenopus and mammalian models?

YIF1B is well conserved across species, with Xenopus laevis YIF1B showing approximately 76% amino acid identity to rat YIF1B . This high conservation suggests similar fundamental functions:

  • Functional complementation approaches:

    • Express Xenopus YIF1B-A in mammalian cells with YIF1B knockdown to assess rescue

    • Test if Xenopus YIF1B-A can interact with mammalian 5-HT1AR

    • Compare subcellular localization patterns across species

  • Domain conservation analysis:

    • Perform detailed sequence comparisons focusing on functional domains

    • Identify conserved motifs likely involved in core functions

    • Map species-specific variations that might relate to specialized functions

  • Experimental comparison table:

FunctionMammalian YIF1BXenopus YIF1B-AExperimental Approach
5-HT1AR bindingBinds C-terminusPredicted conservedGST pull-down, Y2H
Subcellular localizationER/ERGIC vesiclesTo be determinedImmunofluorescence
Trafficking roleDendritic targetingTo be determinedsiRNA knockdown, live imaging
Developmental expressionNeuronal enrichmentTo be determinedIn situ hybridization

What structural features of YIF1B-A are unique to Xenopus compared to mammalian homologs?

To identify Xenopus-specific features of YIF1B-A:

  • Comparative sequence analysis:

    • Multiple sequence alignment of YIF1B from various species

    • Focus on regions showing lower conservation that may indicate species-specific adaptations

    • Identify Xenopus-specific insertions, deletions, or sequence variations

  • Structural prediction approaches:

    • Generate structural models using AlphaFold or similar tools

    • Compare predicted structures between species

    • Identify surface features that might interact with species-specific partners

  • Functional testing of unique regions:

    • Generate chimeric proteins swapping domains between species

    • Perform mutagenesis of Xenopus-specific residues

    • Test binding properties with Xenopus-specific interaction partners

How can Xenopus YIF1B-A be used to model neurological disorders?

Truncating mutations in YIF1B have been linked to progressive encephalopathy in humans . Xenopus models can provide valuable insights:

  • Disease-relevant mutation modeling:

    • Generate equivalent mutations in Xenopus YIF1B-A

    • Assess effects on protein localization, stability, and function

    • Evaluate consequences on neuronal development and function in Xenopus embryos

  • Experimental approaches:

    • CRISPR/Cas9 genome editing to introduce patient-specific mutations

    • Overexpression of mutant forms to assess dominant-negative effects

    • Electrophysiological recordings to assess functional consequences in neurons

  • Phenotypic assessments:

    • Behavioral analysis of tadpoles (swimming patterns, response to stimuli)

    • Histological examination of brain development

    • Molecular characterization of affected pathways

What is the relationship between YIF1B-A and serotonin receptor trafficking in Xenopus neurons?

Based on mammalian studies showing YIF1B's critical role in 5-HT1AR dendritic targeting :

  • Experimental design for Xenopus studies:

    • Co-expression of fluorescently tagged 5-HT1AR and YIF1B-A in Xenopus neurons

    • Live imaging to track receptor trafficking in presence/absence of YIF1B-A

    • siRNA knockdown of YIF1B-A to assess effects on receptor distribution

  • Mechanistic investigations:

    • Map interaction domains between Xenopus 5-HT1AR and YIF1B-A

    • Identify additional components of the trafficking complex

    • Assess effects of neuronal activity on the interaction

  • Methodological considerations:

    • Primary cultures of Xenopus neurons provide an accessible system for trafficking studies

    • In vivo electroporation allows for manipulation of specific neuronal populations

    • Quantitative analysis should include both dendritic targeting efficiency and functional receptor expression

How does YIF1B-A function compare to its interaction with TAPL in lysosomal protein transport?

YIF1B interacts with the lysosomal protein TAPL in humans , suggesting multiple roles in intracellular trafficking:

  • Experimental approaches to study lysosomal interactions:

    • Co-immunoprecipitation of YIF1B-A with Xenopus TAPL homolog

    • Fluorescence co-localization studies in Xenopus cells

    • Functional assays measuring lysosomal protein transport

  • Dual role investigation:

    • Compare binding domains for serotonin receptor versus TAPL interaction

    • Determine if these roles are mutually exclusive or cooperative

    • Test if YIF1B-A knockdown affects both pathways equally

  • Cell-type specific functions:

    • Assess relative importance of each pathway in different cell types

    • Investigate tissue-specific interaction partners

    • Determine if developmental regulation affects pathway preference

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.