Recombinant Xenopus laevis Protein YIF1B-B (yif1b-b)

Shipped with Ice Packs
In Stock

Description

Biological Functions

YIF1B-B plays critical roles in membrane trafficking and organelle organization:

  • ER/Golgi Trafficking: Facilitates anterograde transport from the endoplasmic reticulum (ER) to the Golgi apparatus, akin to its yeast homolog Yif1p .

  • Neuronal Dendritic Targeting: Interacts with the C-terminal domain of the serotonin receptor 5-HT1A (5-HT1AR), enabling its transport to neuronal dendrites .

    • Mechanism: siRNA-mediated knockdown of YIF1B-B disrupts 5-HT1AR dendritic localization, confirming its necessity .

  • Disease Relevance: Human YIF1B mutations are linked to progressive encephalopathy, microcephaly, and epilepsy , highlighting its conserved neurobiological significance.

Key Findings from Studies

  1. Interaction with 5-HT1A Receptor

    • Yeast two-hybrid screens identified YIF1B-B as a binding partner for the 5-HT1AR C-terminus .

    • GST pull-down assays validated this interaction in rat brain extracts and transfected cell lines .

    • Functional Impact: YIF1B-B ensures 5-HT1AR’s dendritic localization, critical for serotonin signaling and antidepressant drug mechanisms .

  2. Subcellular Localization

    • Colocalizes with ER (calregulin) and Golgi (CTR433) markers in COS-7 and LLC-PK1 cells .

    • Operates in vesicles mediating transient intracellular transport .

  3. Evolutionary Conservation

    • Shares 76% identity with Xenopus laevis YIF1B-B, 89–97% with mammalian orthologs, and 28% with yeast Yif1p .

Implications for Drug Development

YIF1B-B’s role in 5-HT1AR trafficking positions it as a potential target for modulating serotonin signaling, offering pathways to develop novel antidepressants . Its conservation across species underscores its fundamental role in cellular trafficking mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yif1b-b; Protein YIF1B-B; YIP1-interacting factor homolog B-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
yif1b-b
Target Protein Sequence
MNQESSFRAPPKRRVRGSNPNISNPHQLFDDTSGGPVPHGGDFPNHSSPALGIPAQAFLS EPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQ DWEVRYQQDTPVAPRFDINAPDLYIPVMAFITYILVAGLALGTQSRFSPEILGMQASSAL AWLIVEVLAILLSLYLVTVNTDLTTVDLVAFSGYKYVGMISGVIAGLLFGNTGYYVVLAW CCISIVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLVR
Uniprot No.

Target Background

Function
Involved in the anterograde traffic pathway from the endoplasmic reticulum to the plasma membrane and the organization of the Golgi architecture.
Database Links

KEGG: xla:432153

UniGene: Xl.57596

Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What are the fundamental properties of Xenopus laevis Protein YIF1B-B?

Protein YIF1B-B (yif1b-b) from Xenopus laevis is a 300 amino acid protein with a molecular mass of approximately 33.3 kDa. It belongs to the evolutionarily conserved YIF1 family of proteins, which are integral membrane proteins primarily involved in membrane trafficking processes. The complete amino acid sequence is:

MNQESSFRAPPKRRVRGSNPNISNPHQLFDDTSGGPVPHGGDFPNHSSPALGIPAQAFLSEPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQDWEVRYQQDTPVAPRFDINAPDLYIPVMAFITYILVAGLALGTQSRFSPEILGMQASSALAWLIVEVLAILLSLYLVTVNTDLTTVDLVAFSGYKYVGMISGVIAGLLFGNTGYYVVLAWCCISIVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLVR

For optimal characterization of the recombinant protein, researchers should employ a combination of mass spectrometry, circular dichroism spectroscopy, and dynamic light scattering to verify protein integrity, secondary structure, and aggregation state, respectively.

How does the membrane topology of YIF1B-B compare to its yeast homologs?

Based on structural predictions and homology with yeast Yip1 proteins, YIF1B-B likely contains multiple transmembrane or hairpin domains with cytosolic amino and carboxy termini. The membrane topology of yeast Yip1p, a homolog of YIF1B-B, was initially characterized with three putative transmembrane domains, though subsequent research suggests a more complex architecture .

To experimentally determine the membrane topology of YIF1B-B, researchers should implement:

  • Protease protection assays with subsequent mass spectrometry analysis

  • Cysteine accessibility methods using membrane-impermeable thiol-reactive reagents

  • Fluorescence protease protection (FPP) assays with strategically placed fluorescent tags

  • Immunofluorescence microscopy with antibodies targeting specific domains under permeabilized and non-permeabilized conditions

What expression systems are most effective for producing recombinant YIF1B-B for structural studies?

For structural studies of membrane proteins like YIF1B-B, several expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsYield (mg/L)Post-translational Modifications
E. coliFast growth, inexpensive, scalableLimited PTMs, inclusion bodies0.5-5Minimal
Insect cellsBetter folding, some PTMsModerate cost, slower growth1-10Moderate
Mammalian cellsNative-like PTMs, proper foldingExpensive, low yield0.1-2Extensive
Xenopus oocytesNative environment, proper foldingVery low scale, specialized equipment<0.1Native-like

For YIF1B-B specifically, insect cell expression systems (particularly Sf9 or High Five cells) using baculovirus vectors represent an optimal balance between proper folding, post-translational modifications, and yield. Fusion tags such as SUMO, MBP, or TrxA can further enhance solubility, while a C-terminal His-tag facilitates purification without disrupting N-terminal trafficking signals that may be present in this membrane protein.

How can researchers effectively track the subcellular localization of YIF1B-B in Xenopus cells?

To accurately determine the subcellular localization of YIF1B-B in Xenopus cells, researchers should employ multiple complementary approaches:

  • Immunofluorescence microscopy using specific antibodies against YIF1B-B alongside organelle markers (particularly Golgi and ER markers)

  • Expression of fluorescently-tagged YIF1B-B (preferably with small tags like mNeonGreen or HaloTag to minimize functional interference)

  • Subcellular fractionation followed by Western blotting analysis

  • Proximity labeling approaches using BioID or APEX2 fusions

When performing colocalization studies, quantitative analysis is essential. As outlined in research on microscopy colocalization analysis, researchers should calculate Pearson's correlation coefficients, Manders' overlap coefficients, or intensity correlation quotients rather than relying on visual inspection alone . For dynamic tracking of YIF1B-B, live-cell imaging with appropriate temporal resolution (typically 1-5 seconds between frames) is recommended to capture vesicular trafficking events.

What protein-protein interactions does YIF1B-B participate in, and how can they be experimentally verified?

Based on homology with yeast Yip proteins, YIF1B-B likely interacts with small GTPases of the Rab family (homologous to yeast Ypt proteins) and potentially with other membrane trafficking machinery . To comprehensively identify and verify these interactions:

  • Co-immunoprecipitation combined with mass spectrometry provides an unbiased approach to identifying interaction partners

  • Yeast two-hybrid screening can identify direct interactions, though interpretation for membrane proteins requires caution

  • Proximity labeling approaches (BioID, APEX2) can identify both stable and transient interactions within the cellular context

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can visualize interactions in live cells

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can quantify binding affinities for purified components

Critically, interaction studies should include appropriate controls for specificity, including paralogs within the YIF1 family and mutant variants with altered binding domains.

What phenotypes result from YIF1B-B depletion or overexpression in Xenopus laevis embryos?

Based on studies of yeast homologs, manipulation of YIF1B-B levels in Xenopus would likely affect membrane trafficking and organelle structure. Depletion of yeast Yip1p led to ER membrane accumulation and aberrant protein secretion and glycosylation, while overexpression caused accumulation of internal ER membranes and blocked membrane trafficking .

To study YIF1B-B function in Xenopus embryos, researchers should implement:

  • Morpholino-mediated knockdown (injected at 1-2 cell stage)

  • CRISPR-Cas9 genome editing to generate stable mutant lines

  • mRNA overexpression to induce gain-of-function phenotypes

Analysis should focus on:

  • Membrane trafficking dynamics using pulse-chase experiments with fluorescent cargo proteins

  • Organelle morphology via transmission electron microscopy and immunofluorescence

  • Protein glycosylation status through lectin staining and mass spectrometry

  • Developmental consequences, particularly in tissues with high secretory activity

What purification strategies yield the highest purity and stability for recombinant YIF1B-B?

As a membrane protein, YIF1B-B presents unique challenges for purification. The following optimized protocol is recommended:

  • Extraction: Solubilize membranes using mild detergents such as DDM (n-Dodecyl β-D-maltoside), LMNG (lauryl maltose neopentyl glycol), or CHAPS at concentrations just above their critical micelle concentration.

  • Purification workflow:

    • Initial capture via immobilized metal affinity chromatography (IMAC) using a His-tag

    • Size exclusion chromatography to remove aggregates and detergent micelles

    • Optional ion exchange chromatography for removal of specific contaminants

  • Stability optimization:

    • Screen detergent/lipid mixtures using differential scanning fluorimetry

    • Consider amphipols or nanodiscs for detergent-free stabilization

    • Include cholesterol and specific phospholipids matching the native membrane environment

  • Quality assessment:

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Negative-stain electron microscopy to verify homogeneity

    • Functional assays to confirm biological activity

How can researchers generate specific antibodies against Xenopus laevis YIF1B-B for immunodetection?

Generation of specific antibodies against YIF1B-B requires careful antigen design to ensure specificity, particularly given the existence of related family members:

  • Antigen selection strategies:

    • Identify unique, surface-exposed peptides using sequence alignments with paralogs

    • Focus on N- or C-terminal regions which typically show greater sequence divergence

    • Consider using purified recombinant protein domains excluding transmembrane regions

  • Recommended immunization protocol:

    • Use rabbits for polyclonal antibodies or mice for monoclonal development

    • Implement a prime-boost strategy with at least 4 immunizations

    • Employ adjuvants suitable for membrane proteins (e.g., TiterMax Gold)

  • Antibody validation requirements:

    • Western blot against recombinant protein and native Xenopus tissue samples

    • Immunoprecipitation efficiency testing

    • Immunofluorescence with appropriate knockdown/knockout controls

    • Cross-reactivity testing against related family members

  • Epitope mapping to confirm the recognized region, enabling strategic experimental design

What approaches are most effective for studying the dynamics of YIF1B-B trafficking in live Xenopus cells?

For studying YIF1B-B trafficking dynamics, advanced live imaging approaches are essential:

  • Construct design considerations:

    • Use photoconvertible fluorescent proteins (e.g., mEos3.2, Dendra2) to pulse-label specific pools

    • Employ self-labeling tags (HaloTag, SNAP-tag) for superior brightness and photostability

    • Validate functionality of fusion proteins by complementation assays

  • Imaging techniques:

    • Spinning disk confocal microscopy for high-speed imaging (10+ frames per second)

    • Total internal reflection fluorescence (TIRF) microscopy for membrane-proximal events

    • Single-molecule tracking for detailed trafficking kinetics

    • Fluorescence recovery after photobleaching (FRAP) to measure mobile fractions

  • Quantitative analysis approaches:

    • Single-particle tracking analysis for vesicle movement parameters

    • Intensity-based flux measurements at organelle interfaces

    • Colocalization dynamics with known trafficking markers

    • Machine learning-based classification of trafficking behaviors

How does YIF1B-B expression change during Xenopus laevis development, and what methods best capture these dynamics?

Studies of developmental gene expression in Xenopus laevis have revealed complex spatiotemporal regulation of many proteins involved in membrane trafficking. For comprehensive analysis of YIF1B-B expression patterns:

  • Temporal expression profiling:

    • qRT-PCR across developmental stages from fertilization to metamorphosis

    • Western blotting with stage-specific lysates

    • RNA-seq analysis leveraging existing developmental transcriptome datasets

  • Spatial expression analysis:

    • Whole-mount in situ hybridization with specific riboprobes

    • Tissue-specific RT-PCR following microdissection

    • Immunohistochemistry on sectioned embryos at key developmental stages

  • Single-cell approaches:

    • Single-cell RNA-seq to identify cell populations with enriched expression

    • Fluorescent reporter knockins using CRISPR/Cas9 genome editing

    • Lineage tracing combined with expression analysis

  • Developmental regulation studies:

    • Promoter analysis to identify stage-specific regulatory elements

    • ChIP-seq to identify transcription factors controlling expression

    • Treatment with developmental signaling pathway modulators to assess regulatory inputs

Research on limb bud development in Xenopus laevis highlights the importance of stage-specific gene expression analysis, and similar approaches should be applied to YIF1B-B .

How can YIF1B-B be used as a tool to study membrane trafficking in Xenopus laevis?

YIF1B-B can serve as both a subject of study and a research tool for investigating membrane dynamics:

  • YIF1B-B as a trafficking marker:

    • Fluorescently tagged YIF1B-B can visualize specific membrane compartments

    • Mutant variants with altered trafficking signals can reveal sorting mechanisms

    • Chimeric constructs with YIF1B-B trafficking domains can redirect cargo proteins

  • YIF1B-B interactome as a platform for discovery:

    • Identification of YIF1B-B binding partners can reveal novel trafficking machinery

    • Comparison of interactomes across developmental stages can highlight regulatory mechanisms

    • Cross-species comparison with mammalian homologs can identify conserved trafficking pathways

  • YIF1B-B in organelle reconstitution systems:

    • In vitro budding assays using purified components including YIF1B-B

    • Reconstitution of minimal trafficking machinery in synthetic membrane systems

    • Bottom-up assembly of functional membrane domains with defined components

What comparative insights can be gained by studying YIF1B-B across different model organisms?

Comparative studies of YIF1B-B homologs can reveal evolutionary conservation and specialization:

  • Cross-species comparison approaches:

    • Sequence conservation analysis focusing on functional domains

    • Complementation assays testing functional interchangeability

    • Localization studies in different cellular contexts

  • Evolutionary insights from different models:

    • Simple eukaryotes (yeast): fundamental trafficking mechanisms

    • Invertebrates (Drosophila, C. elegans): developmental functions

    • Vertebrates (Xenopus, zebrafish, mammals): tissue-specific specializations

  • Technical considerations for comparative studies:

    • Codon optimization for heterologous expression

    • Selection of species-specific antibodies or tagged constructs

    • Accounting for differences in cellular architecture and trafficking pathways

How might structural biology approaches advance our understanding of YIF1B-B function?

Advanced structural biology techniques can provide crucial insights into YIF1B-B:

  • Cryo-electron microscopy approaches:

    • Single-particle analysis of purified YIF1B-B in membrane mimetics

    • Tomography of YIF1B-B-containing membranes from Xenopus cells

    • In situ structural analysis using focused ion beam milling and cryo-ET

  • Integrative structural biology workflow:

    • Crosslinking mass spectrometry to identify domain interactions

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Homology modeling informed by evolutionary covariance analysis

    • Molecular dynamics simulations to predict membrane interactions

  • Structure-function analysis strategy:

    • Systematic mutagenesis based on structural predictions

    • Functional assays measuring trafficking efficiency

    • Interaction studies with identified binding partners

    • In vivo rescue experiments with structure-guided mutants

What are the key challenges in distinguishing the functions of YIF1B-B from closely related family members in Xenopus?

Discriminating between the functions of closely related proteins presents significant challenges:

  • Sequence and structural similarity issues:

    • High conservation in functional domains complicates specific targeting

    • Cross-reactivity of antibodies and probes requires rigorous validation

    • Potential functional redundancy may mask phenotypes

  • Recommended experimental strategies:

    • Design of highly specific CRISPR guide RNAs targeting unique regions

    • Development of isoform-specific antibodies against divergent epitopes

    • Double/triple knockdown approaches with specific rescue constructs

    • Selective tagging of endogenous loci using homology-directed repair

  • Analytical approaches for distinguishing functions:

    • Quantitative phenotyping to detect subtle functional differences

    • Temporal control of gene knockdown using inducible systems

    • Tissue-specific manipulation to bypass early embryonic requirements

    • Careful analysis of potential compensatory mechanisms

How can researchers overcome the difficulties in extracting and purifying functional membrane proteins like YIF1B-B?

Membrane protein purification presents unique challenges that require specialized approaches:

  • Extraction optimization strategy:

    • Systematic detergent screening (ranging from harsh to mild)

    • Native nanodiscs formed using scaffold proteins and native lipids

    • Styrene maleic acid copolymer (SMA) extraction for native lipid preservation

    • Cell-free expression directly into artificial membrane systems

  • Expression system selection criteria:

    • Mammalian cells for complex eukaryotic membrane proteins

    • Insect cells for higher yield while maintaining folding quality

    • Yeast systems for functional complementation approaches

    • Bacterial systems with specialized membrane protein expression strains

  • Stabilization approaches for purified YIF1B-B:

    • Lipid supplementation matching native membrane composition

    • Binding partner co-expression and co-purification

    • Thermostabilizing mutations identified through directed evolution

    • Antibody fragment (Fab) binding to stabilize specific conformations

  • Functional validation methods:

    • Liposome reconstitution with functional assays

    • Native mass spectrometry to verify complex integrity

    • Microscale thermophoresis to confirm ligand binding capacity

    • Proteoliposome-based trafficking assays

By implementing these strategies and drawing from advances across model systems, researchers can effectively investigate the structure, function, and developmental roles of Xenopus laevis Protein YIF1B-B in diverse experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.