Recombinant Xenopus laevis Protein YIPF3 (yipf3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant YIPF3 is produced with a full-length sequence (amino acids 1–341) derived from Xenopus laevis (UniProt ID: Q3B8G4) . Key features include:

  • Expression system: Not explicitly stated, but typically produced in E. coli or mammalian cell lines for eukaryotic post-translational modifications.

  • Tag: A proprietary tag (unspecified type) added during production to facilitate purification and detection .

  • Storage: Tris-based buffer with 50% glycerol, stable at -20°C or -80°C for long-term storage .

Functional Insights

YIPF3 is implicated in:

  • Golgi structure maintenance: Stabilizes Golgi membranes and facilitates vesicular trafficking .

  • Selective autophagy (Golgiphagy): In mammals, YIPF3/YIPF4 complexes act as autophagy receptors, targeting fragmented Golgi membranes to lysosomes via LC3/GABARAP interactions . While direct evidence in Xenopus is lacking, structural conservation suggests similar roles.

  • Hematopoiesis: Proposed involvement in blood cell development, though mechanistic details remain unresolved .

Experimental Use Cases

  • Autophagy studies: Recombinant YIPF3 could model Golgi degradation mechanisms observed in mammalian systems, where phosphorylation of Ser45/Ser46 in the LIR motif enables ATG8 binding .

  • Structural biology: AlphaFold-predicted models of YIPF3–YIPF4 complexes highlight interactions with ATG8 proteins (e.g., GABARAPL1) .

Limitations

  • Species-specific data: Most functional studies focus on human/mouse homologs. Xenopus YIPF3’s role in Golgiphagy remains inferred .

  • Commercial availability: Sold as a research reagent (e.g., CBM15), but peer-reviewed studies using this specific recombinant protein are absent .

Comparative Analysis with Mammalian YIPF3

FeatureXenopus laevis YIPF3Mammalian YIPF3
LIR motifNot experimentally mappedF47-M50 critical for ATG8 binding
PhosphorylationPredicted (Ser45/Ser46)Required for Golgiphagy
Complex partnerLikely YIPF4 (unconfirmed)Forms heterodimer with YIPF4

Future Directions

  • Functional validation: Testing recombinant Xenopus YIPF3 in autophagy assays (e.g., LC3 colocalization).

  • Structural studies: Cryo-EM analysis of YIPF3–YIPF4–ATG8 complexes to clarify binding mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to suit customer needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yipf3; Protein YIPF3; YIP1 family member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
yipf3
Target Protein Sequence
MANSSGSSRNLTAADWGGFDDNMQSGGGAAVIDMENMDDTSGSSFEDMGEIHQHMKEEEE EVEGEGVPEDGEEDGAFLGMKGVQGQLGRQVADEMWQAGKRQASKAFNLYANIDILRPYF DVEPIQVRHRLLESMIPVKMISFPQKIAGELYGPLMLVFTMVAILLHGMKSSGTIIREGT LMGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQTLSLLGYGLFGHCIVLFITYNIHFH SLFYIFWLCIGGLSTLRMVAVLLSRTVGHTQRLIVCGTMAALHMLFLLYLHFAYHKVVEG ILDTLDGQNVPLPIQRVARDLPVGPNTVLNATVQVLLAHSR
Uniprot No.

Target Background

Function
Recombinant Xenopus laevis Protein YIPF3 (yipf3) is involved in maintaining Golgi structure and may play a role in hematopoiesis.
Database Links

KEGG: xla:733391

UniGene: Xl.56471

Protein Families
YIP1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is YIPF3 and what is its function in Xenopus laevis?

YIPF3 (Yip1 domain family, member 3) is a conserved protein that primarily localizes to the Golgi apparatus in Xenopus laevis. Recent research has identified the YIPF3-YIPF4 complex as a selective autophagy receptor for degradation of the Golgi apparatus, marking it as the first characterized receptor for Golgiphagy . The protein contains several evolutionarily conserved putative LC3-interacting region (LIR) motifs in the N-terminal region that face the cytosol, which are critical for its function in autophagy .

To study YIPF3 function:

  • Use EGFP-YIPF3 fusion constructs to observe its juxtanuclear ribbon-like Golgi localization

  • Co-localization studies with Golgi markers like GM130 (cis-Golgi)

  • Examine YIPF3 puncta formation during starvation conditions with lysosomal inhibitors like bafilomycin A1

How does YIPF3 interact with other proteins in cellular pathways?

YIPF3 forms a functional complex with YIPF4, which is critical for Golgiphagy. Key interactions include:

  • YIPF3-YIPF4 Complex Formation: YIPF3 requires YIPF4 for stability, and both proteins must be co-expressed to increase their total amount in cells .

  • ATG8 Family Interactions: YIPF3 interacts with specific ATG8 family proteins through its N-terminal LIR motif. Coimmunoprecipitation analysis has revealed that endogenous YIPF3 interacts with FLAG-tagged LC3B, GABARAP, and GABARAPL1 .

  • LIR Motif-Dependent Interactions: Of the three putative LIR motifs in YIPF3, only the first motif (F47A, M50A) is essential for binding to LC3 and GABARAPL1 .

ProteinInteraction with YIPF3Function
YIPF4Direct complex formationStabilizes YIPF3, essential for Golgiphagy
LC3BBinds via LIR motifAutophagosome formation
GABARAPBinds via LIR motifAutophagosome formation
GABARAPL1Binds via LIR motifAutophagosome formation

What are the optimal conditions for producing and storing recombinant Xenopus laevis YIPF3?

For optimal production and storage of recombinant YIPF3:

Expression Systems:

  • E. coli expression systems have been successfully used for producing recombinant YIPF3

  • For eukaryotic expression, Xenopus oocytes have been used for overexpression studies

Storage Conditions:

  • Store at -20°C or -80°C for extended storage

  • Use Tris-based buffer with 50% glycerol, optimized for protein stability

  • Avoid repeated freeze-thaw cycles

  • Create working aliquots and store at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 30-50% for long-term storage

How can researchers design effective experiments to study YIPF3's role in Golgiphagy?

Experimental Approach for Studying YIPF3-Mediated Golgiphagy:

  • Mutation Analysis:

    • Generate LIR motif mutants (particularly focusing on F47A, M50A mutations in the first LIR motif) to study the requirement of ATG8 interaction

    • Create phosphorylation site mutants to examine the role of phosphorylation in YIPF3-ATG8 interaction

  • Imaging Approaches:

    • Use fluorescently tagged YIPF3 (e.g., EGFP-YIPF3) to monitor subcellular localization

    • Co-localization studies with Golgi markers (GM130, MAN2A1, TMEM165) and autophagy markers (LC3, LAMP1)

    • Monitor puncta formation during starvation in the presence of lysosomal inhibitors

  • Biochemical Assays:

    • Coimmunoprecipitation to detect YIPF3-ATG8 interactions

    • Use the Halo-mGFP-YIPF3 reporter system to monitor lysosome-dependent degradation

    • Western blotting to assess YIPF3 protein levels under different conditions

  • Genetic Approaches:

    • Create YIPF3 knockout lines to study loss-of-function phenotypes

    • Rescue experiments with WT and mutant YIPF3 constructs

What techniques are most effective for detecting YIPF3-ATG8 interactions?

To effectively study YIPF3-ATG8 interactions:

  • Coimmunoprecipitation:

    • Use FLAG-tagged ATG8 proteins (LC3B, GABARAP, GABARAPL1) to pull down endogenous YIPF3

    • Alternatively, use FLAG-tagged YIPF3 to pull down endogenous LC3 or GABARAPL1

    • Include controls with YIPF3 LIR motif mutants to confirm specificity

  • Fluorescence Microscopy:

    • Analyze colocalization of EGFP-YIPF3 with RFP-LC3 during starvation

    • Use super-resolution microscopy for detailed spatial analysis

  • Proximity Ligation Assays:

    • Detect protein-protein interactions in situ with higher sensitivity than conventional colocalization

  • Biochemical Binding Assays:

    • In vitro binding assays with purified recombinant proteins

    • GST pull-down assays using GST-tagged ATG8 proteins

How does phosphorylation affect YIPF3's function in selective autophagy?

Phosphorylation of the LIR motif in YIPF3 appears to be critical for its function in selective autophagy:

  • Enhancement of ATG8 Binding:

    • The upstream sequence of LIRs often contains negatively charged residues including phosphorylated Ser and Thr

    • These phosphorylated residues enhance binding with ATG8s by forming electrostatic interactions in addition to the canonical interaction within the LIR motif

  • Regulation of Golgiphagy:

    • Phosphorylation of the YIPF3 LIR motif is required for YIPF3-YIPF4-mediated Golgiphagy

    • This suggests a mechanism for regulating Golgi turnover through post-translational modifications

To study phosphorylation:

  • Use phospho-mimetic (Ser/Thr to Asp/Glu) and phospho-deficient (Ser/Thr to Ala) mutations

  • Employ phospho-specific antibodies if available

  • Conduct in vitro kinase assays to identify responsible kinases

What are the implications of YIPF3-mediated Golgiphagy in Xenopus development?

Understanding YIPF3's role in development requires consideration of:

  • Temporal Protein Expression Patterns:

    • Large-scale proteomic studies in Xenopus laevis have identified nearly 4,000 proteins with dynamic expression patterns during development from fertilized egg to neurula embryo

    • Examining YIPF3 expression dynamics across developmental stages could reveal stage-specific functions

  • Organelle Remodeling During Development:

    • Proper organelle turnover is essential during development

    • YIPF3-mediated Golgiphagy may be critical during specific developmental windows when cellular reorganization occurs

  • Experimental Approaches:

    • Use temporal knockout or knockdown strategies (morpholinos, CRISPR-Cas9)

    • Perform stage-specific overexpression of wild-type and mutant YIPF3

    • Employ lineage tracing to follow cells with altered YIPF3 expression

How do the LIR motifs in YIPF3 contribute to its specificity in selective autophagy?

The specificity of YIPF3 in selective autophagy is determined by its LIR motifs:

  • LIR Motif Structure and Function:

    • YIPF3 contains three evolutionarily conserved putative LIR motifs in its N-terminal cytosolic region

    • Of these, only the first motif (residues 47-50) is critical for binding to LC3 and GABARAPL1

    • Mutations in this motif (F47A, M50A) completely abolish binding to ATG8 family proteins

  • Selectivity for ATG8 Family Members:

    • YIPF3 shows preferential binding to specific ATG8 family members (LC3B, GABARAP, GABARAPL1)

    • This selectivity may contribute to the specificity of Golgiphagy

  • Experimental Analysis Approaches:

    • Alanine scanning mutagenesis of LIR motifs

    • In vitro binding assays with different ATG8 family members

    • Structural studies using X-ray crystallography or NMR

What are common issues when working with recombinant YIPF3 and how can they be addressed?

Common Issues and Solutions:

  • Protein Solubility Problems:

    • Issue: YIPF3 contains transmembrane domains that may affect solubility

    • Solution: Consider expressing only the soluble N-terminal domain for certain applications

    • Alternative: Use appropriate detergents for membrane protein solubilization

  • Stability Concerns:

    • Issue: Protein degradation during storage

    • Solution: Store in 50% glycerol at -80°C and avoid repeated freeze-thaw cycles

    • Alternative: Lyophilize the protein for longer-term storage

  • Expression Level Challenges:

    • Issue: Low expression levels in heterologous systems

    • Solution: Optimize codon usage for the expression host

    • Alternative: Co-express with YIPF4 to potentially enhance stability

What controls are essential when studying YIPF3 function in autophagy experiments?

Critical Controls for YIPF3 Autophagy Experiments:

  • Genetic Controls:

    • YIPF3 knockout or knockdown cells

    • Cells expressing YIPF3 LIR mutants (particularly F47A, M50A)

    • Rescue experiments with wild-type YIPF3

  • Pharmacological Controls:

    • Bafilomycin A1 treatment to block autophagosome-lysosome fusion

    • Starvation conditions to induce autophagy

    • Comparison between fed and starved states

  • Protein Interaction Controls:

    • YIPF4 co-expression controls (since YIPF3 requires YIPF4 for stability)

    • Non-interacting ATG8 family members as negative controls

    • Competition assays with excess untagged protein

  • Imaging Controls:

    • Co-localization with established markers (GM130, LC3, LAMP1)

    • Time-course analysis to track dynamic changes

    • Appropriate channel bleed-through controls

How can researchers distinguish between direct and indirect effects of YIPF3 manipulation?

To differentiate direct from indirect effects of YIPF3 manipulation:

  • Acute vs. Chronic Manipulation:

    • Use inducible expression/knockdown systems

    • Compare immediate vs. long-term effects after YIPF3 perturbation

  • Rescue Experiments:

    • Test whether wild-type YIPF3 can rescue knockout phenotypes

    • Use domain-specific mutants to pinpoint essential regions

  • Direct Binding Assays:

    • In vitro binding assays with purified components

    • Proximity-based labeling approaches (BioID, APEX)

  • Parallel Pathway Analysis:

    • Monitor changes in related pathways

    • Use inhibitors of potentially connected pathways to test independence

How conserved is YIPF3 across species and what are the implications for research model selection?

Understanding YIPF3 conservation is critical for experimental design:

  • Cross-Species Comparison:

    • Xenopus laevis YIPF3 shares functional domains with mammalian orthologs

    • The four zinc fingers of the DNA binding domain in related proteins are highly conserved (99% when compared to mouse delta and 95% to human YY1 proteins)

  • Model Selection Considerations:

    • Xenopus offers advantages for developmental studies due to large egg size and external development

    • Proteomic studies have generated quantitative data on expression changes of nearly 4,000 proteins during Xenopus development

    • This dataset represents the largest Xenopus proteomic dataset and one of the largest datasets on developmental proteomics for any organism

  • Functional Conservation Testing:

    • Cross-species rescue experiments

    • Domain swap approaches

    • Comparative analysis of interaction partners

How does protein abundance of YIPF3 correlate with mRNA levels in Xenopus development?

Understanding the relationship between YIPF3 transcript and protein levels:

  • General mRNA-Protein Correlation in Xenopus:

    • Studies measuring both transcriptome and proteome in Xenopus have found relatively low correlation (Pearson correlation of 0.32, Spearman correlation of 0.30 in log-log space)

    • This is lower than correlations observed in tissue culture cells

  • Developmental Considerations:

    • The Xenopus egg emerges with a potentially different proteome and transcriptome after maturation

    • Although the correlation of protein and mRNA abundance is weak, proteins are more likely to be detected when the corresponding mRNA is abundant

  • Experimental Approach:

    • Use both RNA-seq and quantitative proteomics (e.g., iTRAQ isotopic labeling and mass spectrometry) to track YIPF3 across developmental stages

    • Consider stage-specific post-transcriptional regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.