Recombinant Xenopus laevis Protein YIPF5 (yipf5)

Shipped with Ice Packs
In Stock

Description

Functional Role

YIPF5 is integral to vesicular trafficking:

  • ER-Golgi Transport: Facilitates cargo shuttling between the ER and Golgi, critical for secretory pathway efficiency .

  • Prohormone Processing: In pancreatic beta cells, YIPF5 ensures proper transport of proinsulin to the Golgi for maturation .

  • Golgi Structure Maintenance: Depletion disrupts Golgi integrity, underscoring its structural role .

Production and Purification

Recombinant YIPF5 is typically expressed in eukaryotic systems (e.g., HEK293 or insect cells) to ensure proper folding and post-translational modifications. Key steps include:

  1. Vector Design: Codon-optimized for X. laevis expression.

  2. Affinity Chromatography: Tags (e.g., His-tag) enable purification via nickel or glutathione columns .

  3. Quality Control: Validated via SDS-PAGE, Western blot (using antibodies like Proteintech 12931-1-AP), and mass spectrometry .

Antibody Development

Multiple antibodies against YIPF5 are available, supporting diverse experimental workflows:

AntibodyHostApplicationsReactivity
Proteintech 12931-1-APRabbitWB, IHC, ELISAHuman, Mouse, Rat
ABIN653506RabbitWB, IHC (paraffin)Human, Mouse
Thermo Fisher PA5-67301RabbitIF, IPBroad cross-species (91% mouse identity)

Proteomic Studies

  • Xenopus Egg Proteomics: A landmark study identified >11,000 proteins in X. laevis eggs, establishing YIPF5 as part of the secretory machinery .

  • Concentration Estimation: Quantitative proteomics estimated YIPF5 at ~30 nM in eggs, correlating with its role in high-throughput trafficking .

Key Findings

  • RNA-Binding Partners: In X. laevis egg extracts, YIPF5-associated transcripts encode proteins involved in cell adhesion and membrane dynamics, suggesting regulatory cross-talk .

  • Disease Links: Human orthologs of YIPF5 are implicated in congenital disorders of glycosylation and diabetes due to ER-Golgi trafficking defects .

Technical Considerations

  • Stability: Avoid repeated freeze-thaw cycles; glycerol in storage buffers prevents aggregation .

  • Activity Assays: Functional validation often involves co-immunoprecipitation with Rab GTPases or tracking fluorescently labeled cargo (e.g., proinsulin) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
yipf5; Protein YIPF5; YIP1 family member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
yipf5
Target Protein Sequence
MSNFDNFNTDFYQTSYSIDDQSQGYNYNAGGAQYSKQYPYDPYSQQGGFILQEMNQQQQP YTGQIYQPTQTYTPTATESVYGSTFDDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSI MNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAMGCLGMYCLLNLMSMTGVSFGCVS SVLGYCLLPMIILSTFAVIFSLQGILGIVLAALIIGWCSFSASKIFISALAMDGQQLLVA YPCALLYGVFALISVF
Uniprot No.

Target Background

Function
Plays a crucial role in the transport process between the endoplasmic reticulum and Golgi apparatus.
Database Links

KEGG: xla:380087

UniGene: Xl.63896

Protein Families
YIP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

Why is Xenopus laevis utilized as a model organism for protein studies?

Xenopus laevis offers several significant advantages as a model organism for protein studies:

  • Ease of obtaining and maintaining cultures: Xenopus neural tubes and retinal ganglion cells can be obtained approximately one day after fertilization, which is considerably faster than other model systems like chicken (6 days) or rodent (16-18 days) embryos .

  • Large growth cones: Xenopus laevis neurons extend growth cones 10-30 μm in diameter, significantly larger than those from rat hippocampal neurons (5-10 μm) or chicken embryos. This size advantage makes them ideal for studying cytoskeletal dynamics .

  • Sequenced genome: The Xenopus genome has been sequenced, allowing for gene expression modifications through exogenous molecules .

  • Low maintenance requirements: Xenopus cell cultures do not require special culture conditions and are suitable for long periods of live imaging .

How does recombinant YIPF5 protein differ from native YIPF5 in Xenopus laevis?

Recombinant Xenopus laevis YIPF5 protein is produced in an E. coli expression system and contains an N-terminal His tag, which distinguishes it from the native protein. This recombinant version is engineered to include the full-length protein (amino acids 1-256) while maintaining high purity (greater than 90% as determined by SDS-PAGE). The addition of the His tag facilitates protein purification and detection in experimental settings but may slightly alter the protein's properties compared to its native form .

What are the optimal storage and reconstitution conditions for recombinant YIPF5 protein?

Recombinant YIPF5 protein requires careful handling to maintain its structural integrity and activity. The optimal storage and reconstitution conditions are:

Storage Conditions:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • The recommended final concentration of glycerol is 50%

How can researchers effectively incorporate YIPF5 in Xenopus laevis cytoskeletal studies?

When incorporating YIPF5 in Xenopus laevis cytoskeletal studies, researchers should consider the following methodological approach:

  • Culturing System Selection: Utilize Xenopus laevis neural tube explants (from stage 20 embryos) or retinal ganglion cells (from stage 28 embryos) for cytoskeletal dynamics studies, as these provide optimally sized growth cones for imaging .

  • Imaging Optimization: Take advantage of the relatively large growth cones (10-30 μm in diameter) for high-resolution imaging of cytoskeletal components. This is particularly important when studying potential interactions between YIPF5 and cytoskeletal elements .

  • Experimental Design Considerations:

    • For live imaging experiments, maintain cultures in simple media without special conditions

    • Design experiments that can leverage the robust nature of Xenopus cultures, which can be maintained for long periods of live imaging

    • Consider the role of YIPF5 in membrane trafficking when designing experiments involving growth cone dynamics or axon pathfinding

  • Protein Delivery Methods:

    • Microinjection of mRNA encoding tagged YIPF5 variants

    • Application of recombinant YIPF5 protein to cultures

    • Gene expression modification through CRISPR/Cas9 or morpholinos

What technical challenges should researchers anticipate when working with recombinant YIPF5?

Researchers working with recombinant YIPF5 should be prepared to address several technical challenges:

  • Protein Stability Issues:

    • Repeated freeze-thaw cycles significantly reduce protein activity

    • Long-term storage without proper aliquoting may lead to degradation

    • Lyophilized powder form requires careful reconstitution to maintain structural integrity

  • Experimental Validation:

    • Confirming that the His-tagged recombinant protein maintains native functionality

    • Ensuring that the E. coli-expressed protein has proper folding and post-translational modifications

    • Distinguishing between effects of the recombinant protein and endogenous YIPF5

  • Species-Specific Considerations:

    • When designing experiments comparing Xenopus YIPF5 with orthologs from other species, researchers should account for potential functional differences

    • Single amino acid mismatches make peptide identification impossible in mass spectrometry, requiring species-specific reference databases

  • Reference Database Challenges:

    • Using appropriate protein reference databases for proteomic studies

    • PHROG (a mRNA-based approach) identifies approximately 10% more peptides compared to preliminary gene models from genome assembly

How does YIPF5 potentially contribute to axon pathfinding mechanisms in Xenopus laevis?

While the specific role of YIPF5 in axon pathfinding has not been fully characterized in the provided search results, we can hypothesize its potential contributions based on Xenopus laevis growth cone studies:

Axon pathfinding in Xenopus laevis involves complex cytoskeletal dynamics that regulate growth cone adhesion, extension, and guidance. YIPF5, as a membrane protein, may participate in several key processes:

  • Membrane Trafficking Regulation: YIPF5 may modulate the delivery of adhesion molecules or receptors to the growth cone membrane, which is critical for proper axon guidance. In Xenopus, point contacts bind growth cones to extracellular matrix (ECM) and are essential for neurite growth and dynamics .

  • Cytoskeletal Interaction: Through its potential interaction with cytoskeletal components, YIPF5 might influence F-actin dynamics or microtubule organization in growth cones. Research has shown that in Xenopus laevis, coordinated Rho GTPase activity is necessary for generating point contacts that stimulate neurite growth .

  • Vesicle Transport: YIPF5 may facilitate the transport of vesicles containing guidance cue receptors or adhesion molecules along microtubules in the growth cone. The relatively large size of Xenopus growth cones (10-30 μm) makes them ideal for studying such processes .

  • ECM Remodeling: YIPF5 could potentially be involved in regulating proteins that remodel the ECM. Studies have shown that Xenopus growth cones extend F-actin-rich invadosomes containing metalloproteinases to promote ECM remodeling and proper axon extension .

What proteomics approaches are most effective for studying YIPF5 interactions in Xenopus laevis?

For studying YIPF5 interactions in Xenopus laevis, researchers should implement comprehensive proteomics strategies that overcome the challenges inherent to non-model organisms:

  • Reference Database Development:

    • Create a high-quality reference proteome by combining multiple sources of mRNA information

    • Utilize PHROG (a method that combines mRNA from various sources) for maximum coverage

    • When possible, incorporate RNA-seq data specific to your tissues of interest

  • Sample Preparation Optimization:

    • Digest proteins with both LysC and Trypsin or LysC alone

    • Fractionate samples with medium pH reverse-phase columns before LC-MS analysis

    • Consider subcellular fractionation to enrich for membrane proteins (where YIPF5 is likely to be found)

  • Quantitative Approaches:

    • Implement stable isotope labeling or label-free quantification to assess differential interactions

    • Quantify protein concentration changes to approximately 2-fold precision

    • Account for protein abundance when analyzing interaction networks

  • Data Analysis Considerations:

    • When analyzing LC-MS data, search against the PHROG reference set for maximum peptide identification

    • Combine PHROG with preliminary gene models to improve coverage

    • Use orthogonal validation methods to confirm key interactions

How can evolutionary conservation analysis of YIPF5 inform functional studies?

Evolutionary conservation analysis of YIPF5 can provide valuable insights for functional studies through several approaches:

  • Cross-Species Comparison:

    • Compare YIPF5 sequences across different model organisms to identify highly conserved domains

    • The number of peptides identified decreases with evolutionary distance, reflecting fewer exactly matched peptides

    • Focus functional studies on regions that show high conservation, as these likely represent critical functional domains

  • Homolog Identification:

    • Identify YIPF5 homologs in other species, such as Dictyostelium discoideum, rat, chicken, and mouse

    • Compare function across species to establish evolutionarily conserved roles

    • Use knowledge from better-studied organisms to guide hypotheses in Xenopus laevis

  • Domain Analysis:

    • Analyze the conservation of specific protein domains across species

    • Determine if the transmembrane regions and other structural features of YIPF5 are preserved

    • Predict functional importance based on evolutionary pressure to maintain specific structural elements

  • Reference Set Development:

    • Utilize sequence similarity to proteins from related species for reading frame detection, frame-shift correction, and annotation

    • Create a more comprehensive functional map of YIPF5 by integrating cross-species data

What are common sources of experimental variability when working with recombinant YIPF5, and how can they be controlled?

When working with recombinant YIPF5, researchers may encounter several sources of experimental variability that should be carefully controlled:

  • Protein Stability and Activity:

    • Variability Source: Loss of protein activity due to improper storage or reconstitution

    • Solution: Strictly adhere to recommended storage conditions (-20°C/-80°C); avoid repeated freeze-thaw cycles; reconstitute protein immediately before use; add glycerol (final concentration 50%) for long-term storage

  • Batch-to-Batch Variation:

    • Variability Source: Differences in protein expression, purification, and yield between batches

    • Solution: Implement quality control measures for each batch, including SDS-PAGE verification of purity (>90%); use consistent purification protocols; characterize each batch functionally before use

  • Experimental Design Inconsistencies:

    • Variability Source: Differences in Xenopus culture conditions or developmental stages

    • Solution: Standardize protocols for culturing Xenopus neurons; use consistent developmental stages (stage 28 for retinal ganglion cells, stage 20 for neural tube explants); document culture conditions meticulously

  • Imaging Variability:

    • Variability Source: Inconsistent imaging parameters or growth cone selection

    • Solution: Establish standardized imaging protocols; define clear criteria for growth cone selection; use internal controls for normalization across experiments

  • Proteomics Data Variation:

    • Variability Source: Differences in protein identification due to reference database quality

    • Solution: Use the most comprehensive reference set available (combining PHROG with preliminary gene models); implement consistent data analysis pipelines; validate key findings using orthogonal methods

How can researchers effectively analyze YIPF5 localization and function in Xenopus laevis neurons?

To effectively analyze YIPF5 localization and function in Xenopus laevis neurons, researchers should implement a multi-faceted approach:

  • High-Resolution Imaging Techniques:

    • Take advantage of the relatively large growth cones (10-30 μm) in Xenopus laevis neurons

    • Implement confocal or super-resolution microscopy to visualize subcellular localization

    • Use live imaging to track YIPF5 dynamics during growth cone motility and axon pathfinding

  • Co-localization Studies:

    • Examine co-localization with cytoskeletal components (actin, microtubules, neurofilaments)

    • Investigate potential association with membrane compartments and trafficking vesicles

    • Quantify spatial relationships using appropriate statistical measures

  • Functional Perturbation Approaches:

    • Design loss-of-function experiments using morpholinos or CRISPR/Cas9

    • Implement gain-of-function studies with overexpression of wild-type or mutant YIPF5

    • Create domain-specific mutations to map functional regions of the protein

  • Quantitative Analysis Methods:

    • Measure growth cone morphology parameters (area, perimeter, filopodia number)

    • Analyze axon outgrowth rates and guidance responses

    • Quantify cytoskeletal dynamics parameters in the presence/absence of functional YIPF5

  • Proteomic Validation:

    • Identify YIPF5 interaction partners using immunoprecipitation followed by mass spectrometry

    • Use a comprehensive reference database combining PHROG with preliminary gene models

    • Validate key interactions using biochemical and cell biological approaches

What are the potential sources of data contradiction in YIPF5 research and how can they be reconciled?

Research on YIPF5 may yield contradictory results due to several factors:

  • Reference Database Discrepancies:

    • Contradiction Source: Different protein identification results depending on the reference database used

    • Resolution: Utilize the most comprehensive reference set available; combine PHROG (which identifies ~10% more peptides than preliminary gene models) with gene models for maximum coverage; document the specific database used in all publications

  • Model System Variations:

    • Contradiction Source: Differences in YIPF5 function across different model organisms

    • Resolution: Acknowledge species-specific differences; conduct cross-species validation; consider evolutionary conservation when interpreting results; be cautious when extrapolating from one species to another

  • Protein Tag Interference:

    • Contradiction Source: Recombinant YIPF5 with His-tag may behave differently than native protein

    • Resolution: Validate key findings with both tagged and untagged proteins; position tags strategically to minimize functional interference; consider using multiple tag types and positions

  • Developmental Stage Differences:

    • Contradiction Source: YIPF5 function may vary across developmental stages

    • Resolution: Clearly document the specific developmental stages used (e.g., stage 28 for retinal ganglion cells, stage 20 for neural tube explants); conduct stage-specific analyses; avoid generalizing findings across all developmental periods

  • Methodology Variation:

    • Contradiction Source: Different experimental approaches may yield different results

    • Resolution: Implement multiple complementary methodologies; validate key findings using orthogonal techniques; standardize protocols across research groups; clearly document all experimental parameters

What emerging technologies could enhance YIPF5 research in Xenopus laevis?

Several emerging technologies hold promise for advancing YIPF5 research in Xenopus laevis:

  • CRISPR/Cas9 Gene Editing:

    • Application: Generate YIPF5 knockout or knock-in Xenopus models

    • Advantage: Allows precise genetic manipulation to study loss-of-function or introduce specific mutations

    • Implementation: Design guide RNAs targeting YIPF5; inject into early-stage embryos; validate editing efficiency

  • Advanced Proteomics Approaches:

    • Application: Deep proteome analysis combining multiple fractionation techniques

    • Advantage: Enhances coverage of low-abundance proteins and post-translational modifications

    • Implementation: Combine LysC and Trypsin digestion with medium pH reverse-phase fractionation and advanced LC-MS

  • Super-Resolution Microscopy:

    • Application: Visualize YIPF5 localization and dynamics at nanoscale resolution

    • Advantage: Leverages the relatively large size of Xenopus growth cones (10-30 μm) for detailed imaging

    • Implementation: Apply techniques such as STED, PALM, or STORM to visualize YIPF5 in relation to cytoskeletal components

  • Optogenetic Tools:

    • Application: Spatiotemporally control YIPF5 function in living neurons

    • Advantage: Allows precise manipulation of protein activity during specific phases of axon guidance

    • Implementation: Develop light-sensitive YIPF5 variants; express in Xenopus neurons; manipulate with targeted light stimulation

  • Improved Bioinformatics Approaches:

    • Application: Enhanced protein reference databases combining genomic and transcriptomic data

    • Advantage: More accurate protein identification in proteomic studies

    • Implementation: Further develop PHROG-like approaches that combine multiple mRNA sources for maximum coverage

How can YIPF5 research in Xenopus laevis contribute to understanding human development and disease?

Research on YIPF5 in Xenopus laevis can provide valuable insights into human development and disease through several translational pathways:

  • Evolutionary Conservation:

    • The fundamental cellular processes involving YIPF5 are likely conserved across vertebrates

    • Findings in Xenopus can inform hypotheses about YIPF5 function in human development

    • Comparative studies can identify conserved functional domains and interaction partners

  • Neurodevelopmental Disorders:

    • If YIPF5 plays a role in axon pathfinding or neuronal development in Xenopus, it may have implications for human neurodevelopmental disorders

    • The relatively simple nervous system of Xenopus tadpoles allows for clear observation of neuronal pathfinding defects

    • Findings could inform research on conditions involving aberrant axon guidance

  • Cell Biological Mechanisms:

    • YIPF5's potential role in membrane trafficking or cytoskeletal regulation may have broad implications

    • Understanding these fundamental processes in Xenopus can elucidate similar mechanisms in human cells

    • Such insights could inform research on diseases involving membrane dysfunction or cytoskeletal abnormalities

  • Method Development:

    • Techniques optimized for YIPF5 study in Xenopus, such as the PHROG approach for proteomics, can be adapted for research in human samples

    • These methodological advances can improve protein identification and characterization in human studies

  • Drug Target Identification:

    • If YIPF5 is identified as a critical regulator of specific developmental processes, it could represent a potential drug target

    • Xenopus models allow for cost-effective screening of compounds that modulate YIPF5 function

    • Promising compounds could then be tested in mammalian models before clinical translation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.