Recombinant Xenopus laevis Proximal tubules-expressed gene protein (pteg)

Shipped with Ice Packs
In Stock

Description

Characteristics of Recombinant Xenopus laevis Proximal Tubules-Expressed Gene Protein (pteg)

  • Species: The protein is derived from Xenopus laevis, a species commonly used in biological research.

  • Uniprot Number: Q6XQ84.

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for this protein.

  • Storage Conditions: Store at -20°C for short-term storage or -80°C for extended storage. Repeated freezing and thawing is not recommended.

  • Amino Acid Sequence: The sequence begins with MFSLQHVLLILISLGQVYSQQVHHNAGRKFPQWLTGLIAMTVFLFLVLVVYVAKMFWDKR SQESINMKDIEEVVANGTSECCEARKENQYISCNMKDLRSSEHIHAYENPIEVNDNVRST AM.

  • Protein Names: Recommended name is Proximal Tubules-Expressed Gene Protein, with alternative names including MAP17-like protein and PDZK1-interacting protein 1-like.

  • Gene Name: pteg.

  • Expression Region: The full-length protein is expressed from amino acids 1 to 122.

Research Findings and Applications

While specific research findings on the biological functions of the Proximal Tubules-Expressed Gene Protein (pteg) are scarce, recombinant proteins like pteg are often used in research for studying protein interactions, signaling pathways, and potential therapeutic applications. The use of Xenopus laevis as a model organism is common due to its well-understood developmental biology and ease of manipulation.

Table: Characteristics of Recombinant Xenopus laevis Proximal Tubules-Expressed Gene Protein (pteg)

CharacteristicDescription
SpeciesXenopus laevis
Uniprot NumberQ6XQ84
Tag InformationDetermined during production
Storage BufferTris-based with 50% glycerol
Storage Conditions-20°C or -80°C
Amino Acid SequenceBegins with MFSLQHVLLILISLGQVYSQQVHHNAGRKFPQWLTGLIAMTVFLFLVLVVYVAKMFWDKR SQESINMKDIEEVVANGTSECCEARKENQYISCNMKDLRSSEHIHAYENPIEVNDNVRST AM
Protein NamesProximal Tubules-Expressed Gene Protein, MAP17-like protein, PDZK1-interacting protein 1-like
Gene Namepteg
Expression RegionAmino acids 1-122

Future Research Directions

Given the limited information available on the Proximal Tubules-Expressed Gene Protein (pteg), future research should focus on elucidating its biological functions, potential interactions with other proteins, and its role in kidney physiology. Additionally, exploring its potential applications in biomedical research or therapeutic development could provide valuable insights into its utility beyond basic research.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pteg; Proximal tubules-expressed gene protein; Xpteg; MAP17-like protein; PDZK1-interacting protein 1-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
pteg
Target Protein Sequence
MFSLQHVLLILISLGQVYSQQVHHNAGRKFPQWLTGLIAMTVFLFLVLVVYVAKMFWDKR SQESINMKDIEEVVANGTSECCEARKENQYISCNMKDLRSSEHIHAYENPIEVNDNVRST AM
Uniprot No.

Target Background

Function
Essential for pronephric tubule development, acting upstream of pax8 and lhx1/lim1 and downstream of retinoic acid signaling to induce pronephric mesoderm to form pronephric tubule-specific cells.
Gene References Into Functions
  1. XPteg functions as a direct transcriptional target of RA signaling to regulate pronephric tubulogenesis in early Xenopus development. PMID: 19909807
Database Links

KEGG: xla:445820

UniGene: Xl.34969

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in prospective pronephric mesoderm at the late gastrula stage. After neurulation, expressed in the intermediate mesoderm, eye placode and blood islands. Expression becomes restricted to the pronephric proximal tubule during embryogenesis, but is

Q&A

What is Xenopus laevis Proximal tubules-expressed gene protein (pteg)?

Xenopus laevis Proximal tubules-expressed gene protein (pteg) is a 122-amino acid protein primarily expressed in the proximal tubules of Xenopus kidneys. It is also known by several synonyms including Xpteg, MAP17-like protein, and PDZK1-interacting protein 1-like . This protein belongs to a family of small membrane-associated proteins that play roles in epithelial cell function and transport processes. Pteg has structural and functional similarities to mammalian MAP17 proteins, which are involved in protein-protein interactions through PDZ domains and may participate in transmembrane transport processes.

How is recombinant Xenopus laevis pteg typically expressed and purified?

Recombinant Xenopus laevis pteg is typically expressed in E. coli expression systems using vectors that incorporate an N-terminal His-tag for purification purposes . The expression process generally follows these steps:

  • Cloning of the pteg coding sequence into an appropriate expression vector, such as pT7-based vectors similar to those used for other Xenopus proteins

  • Transformation of the construct into a suitable E. coli strain (such as Rosetta, which enhances expression of eukaryotic proteins by supplying tRNAs for rare codons)

  • Induction of protein expression with IPTG under optimized temperature and duration conditions

  • Cell lysis using sonication or mechanical disruption

  • Purification via nickel affinity chromatography utilizing the His-tag

  • Further purification steps may include size exclusion chromatography and ion-exchange chromatography

  • Confirmation of purity by SDS-PAGE analysis, showing greater than 90% purity

The recombinant protein is typically lyophilized for storage stability, and purity is assessed using SDS-PAGE techniques to ensure quality control for downstream applications .

What are the optimal storage and reconstitution conditions for recombinant Xenopus laevis pteg?

Optimal storage and reconstitution conditions for recombinant Xenopus laevis pteg are critical for maintaining protein stability and functionality:

Storage conditions:

  • Store lyophilized powder at -20°C to -80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires -20°C to -80°C with the addition of 5-50% glycerol (standard is 50%)

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. For research applications requiring consistent results, it is advisable to use freshly reconstituted protein or aliquots that have undergone minimal freeze-thaw cycles.

What experimental systems are available for studying Xenopus laevis pteg function?

Several experimental systems are available for studying Xenopus laevis pteg function, each with specific advantages for different research questions:

In vitro systems:

  • Recombinant protein-based assays utilizing purified His-tagged pteg

  • Cell-free translation systems using Xenopus egg extracts

  • Cell culture systems (including Xenopus A6 kidney cells)

Ex vivo systems:

  • Isolated Xenopus oocytes for protein expression and functional studies

  • Isolated proximal tubule preparations for transport studies

In vivo systems:

  • Transgenic Xenopus models using restriction enzyme-mediated insertion (REMI) technology

  • Transgenic isogenetic Xenopus clones (e.g., LG-6, LG-15) which offer advantages for immunological and developmental studies

  • CRISPR/Cas9-mediated gene editing in Xenopus embryos

For transgenic approaches, the REMI method has proven particularly effective in Xenopus laevis. This technique involves mixing transgene DNA with purified sperm, restriction enzymes, and egg extract, followed by injection into unfertilized eggs . This allows for correct spatial and temporal regulation of integrated constructs and avoids chimeric embryos, which is an advantage over some other model systems .

How can transgenic approaches be used to study pteg expression and function?

Transgenic approaches offer powerful tools for studying pteg expression patterns and functional roles in Xenopus laevis:

Generation of pteg reporter lines:

  • Create a construct containing the pteg promoter driving expression of a reporter gene (e.g., GFP)

  • Use REMI technology for integration into the Xenopus genome

  • The transgene can be integrated into the male genome prior to fertilization, resulting in non-chimeric embryos

  • Screen larvae for reporter expression using fluorescence microscopy

  • Monitor spatial and temporal expression patterns during development

Functional studies using overexpression or knockdown:

  • Overexpression can be achieved using constitutive or inducible promoters

  • For the "Sleeping Beauty" transposase system, dejellied eggs can be co-injected with transposase mRNA and a vector containing the pteg gene under control of a suitable promoter

  • Expression can be confirmed by fluorescence microscopy at pre-metamorphic stages (approximately stage 56, 1 month old)

Advantages of Xenopus transgenic systems:

  • Large-scale transgenesis is possible in Xenopus laevis embryos

  • Correct spatial and temporal regulation of integrated promoter constructs

  • Non-chimeric embryos eliminate the need for breeding to obtain non-mosaic animals

  • Transparent embryos allow for direct visualization of reporter gene expression

It should be noted that exchange of genetic material between male and female genomes and multiple gene insertions have been observed in some cases, which should be considered when interpreting results .

What are the technical challenges in working with recombinant Xenopus proteins?

Working with recombinant Xenopus proteins presents several technical challenges that researchers should anticipate:

Expression system challenges:

  • Codon bias differences between Xenopus and bacterial expression systems may reduce expression efficiency

  • Post-translational modifications present in Xenopus may be absent in bacterial systems

  • Membrane proteins like pteg may form inclusion bodies in bacterial expression systems

Structural and biochemical challenges:

  • Xenopus proteins can exhibit unexpected electrophoretic mobility on SDS-PAGE, as observed with X b5 which migrates at ~25 kDa despite a predicted mass of 17 kDa

  • SDS- and reduction-resistant structural features may complicate analysis

  • Confirmation of correct folding and function requires specialized assays

Purification challenges:

ChallengeSolution Strategy
Low solubilityOptimize buffer conditions; use solubility tags
AggregationInclude stabilizing agents (e.g., trehalose)
Loss of function during purificationGentle purification methods; maintain reducing conditions
Contaminants with similar propertiesMulti-step purification strategies

Reconstitution and stability issues:

  • Proper reconstitution is critical for activity (recommended in deionized sterile water to 0.1-1.0 mg/mL)

  • Addition of 5-50% glycerol helps maintain stability during storage

  • Working aliquots should be stored at 4°C and used within one week

  • Avoid repeated freeze-thaw cycles which can reduce protein activity

These challenges require careful optimization of protocols and validation of protein quality before proceeding to functional studies.

How can protein-protein interaction studies be designed for Xenopus laevis pteg?

Designing comprehensive protein-protein interaction studies for Xenopus laevis pteg requires multiple complementary approaches:

In vitro interaction assays:

  • Pull-down assays: Using His-tagged recombinant pteg as bait to identify interacting partners from Xenopus tissue lysates

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics measurements between pteg and candidate interacting proteins

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding

  • Yeast two-hybrid screening: Using pteg as bait against Xenopus cDNA libraries

Cellular interaction assays:

  • Co-immunoprecipitation: From Xenopus tissues or cells expressing tagged pteg

  • Proximity Labeling: Using BioID or APEX2 fusions to identify proteins in close proximity to pteg in living cells

  • Fluorescence Resonance Energy Transfer (FRET): For studying interactions in live cells using fluorescently tagged proteins

Validation and functional characterization:

  • Domain mapping: Creating truncation mutants to identify interaction domains

  • Competitive binding assays: To determine binding specificity

  • Functional assays: Assessing how interactions affect pteg function in proximal tubule cells

Given that pteg is a putative PDZK1-interacting protein, special attention should be paid to PDZ domain interactions. Similar to approaches used with other Xenopus proteins, chimeric constructs combining domains from human and Xenopus proteins can help identify species-specific interaction determinants .

What methodologies can be used to study pteg's role in proximal tubule function?

To elucidate pteg's role in proximal tubule function, researchers can employ several specialized methodologies:

Ex vivo tubule transport studies:

  • Isolate proximal tubule segments from Xenopus laevis kidneys

  • Perfuse isolated tubules with fluorescent substrates

  • Measure transport rates in the presence of pteg inhibitors or in tubules from transgenic animals with modified pteg expression

  • Use video-enhanced DIC microscopy to observe structural changes

Electrophysiological approaches:

  • Patch-clamp recordings of proximal tubule cells to measure ion channel activity

  • Two-electrode voltage clamp in Xenopus oocytes expressing pteg and potential partner proteins

  • Transepithelial electrical measurements in polarized cell cultures

Cellular localization studies:

  • Immunohistochemistry with anti-pteg antibodies in kidney sections

  • Live cell imaging using fluorescently tagged pteg in Xenopus cell lines

  • Electron microscopy to determine subcellular localization with nanometer resolution

Functional genomics approaches:

  • CRISPR/Cas9-mediated gene editing to create pteg knockouts

  • RNA-seq analysis of proximal tubule cells with modulated pteg expression

  • Metabolomic analysis to identify changes in small molecule transport

Xenopus embryonic kidney development model:

  • The development of pronephric tubules in Xenopus embryos provides an accessible model for studying pteg's role in kidney development and function

  • Transgenic approaches using the REMI method allow visualization of pteg expression during tubule formation

  • Time-lapse imaging of fluorescently labeled pteg can reveal dynamic changes during tubulogenesis

How do pteg protein structure and function compare between Xenopus laevis and other species?

Comparative analysis of pteg across species reveals important evolutionary and functional insights:

Structural comparisons:

  • The 122-amino acid Xenopus laevis pteg shares structural features with mammalian MAP17 proteins

  • Like other Xenopus proteins such as cytochrome b5 (b5), pteg may display unusual electrophoretic mobility properties that differ from mammalian homologs

  • Sequence alignment reveals conserved transmembrane domains and potential PDZ-binding motifs

Functional comparisons:

  • Xenopus pteg, like mammalian MAP17, is likely involved in epithelial transport processes

  • Species-specific differences in protein-protein interactions may exist, similar to observations with other Xenopus proteins like cytochrome b5, which shows differential interaction patterns compared to human homologs

Evolutionary adaptations:

  • Amphibian-specific features of pteg may reflect adaptations to different osmotic environments

  • Kidney proximal tubule functions have evolved different regulatory mechanisms across vertebrate species

Comparative protein expression systems:

SpeciesExpression System CompatibilityPost-translational ModificationsFunctional Conservation
Xenopus laevisE. coli (demonstrated) LimitedReference standard
HumanMammalian cells preferredExtensivePartial functional overlap
MouseBoth bacterial and mammalianModerateHigh conservation with human
ZebrafishE. coli systemsLimitedModerate conservation

When designing experiments involving pteg across species, researchers should consider these differences, particularly in protein-protein interaction studies where species-specific interfaces may exist. Chimeric constructs, such as those developed for cytochrome b5 studies combining human and Xenopus domains , can be valuable tools for mapping functional conservation and divergence.

What are the most effective approaches for studying pteg in Xenopus developmental contexts?

Studying pteg in Xenopus developmental contexts requires specialized approaches that take advantage of the unique features of this model system:

Temporal expression profiling:

  • Quantitative RT-PCR at different developmental stages

  • Western blotting of stage-specific embryo lysates

  • In situ hybridization to visualize spatial expression patterns during development

  • Single-cell RNA-seq to identify cell populations expressing pteg during organogenesis

Functional perturbation strategies:

  • Morpholino oligonucleotides for targeted knockdown in early development

  • CRISPR/Cas9 gene editing for generating knockout or knock-in lines

  • Inducible transgene expression using heat shock or chemical inducers

  • Targeted protein degradation approaches (e.g., auxin-inducible degron systems)

Transgenic reporter systems:

  • REMI method for generating transgenic Xenopus embryos with pteg-reporter constructs

  • "Sleeping Beauty" transposase system for efficient transgene integration

  • Dual fluorescent reporter systems for simultaneous visualization of pteg and interacting proteins

Live imaging techniques:

  • Light sheet microscopy for whole-embryo imaging of pteg-GFP expression

  • Confocal time-lapse microscopy for cellular dynamics studies

  • Super-resolution microscopy for subcellular localization during tubulogenesis

One of the significant advantages of using Xenopus for developmental studies is that transgenesis using the REMI method allows integration of the transgene into the male genome prior to fertilization, resulting in non-chimeric embryos that show correct spatial and temporal regulation of integrated constructs . This eliminates the need for breeding animals to obtain non-mosaic lines, accelerating the research timeline.

What is the optimal protocol for reconstituting and validating recombinant Xenopus laevis pteg?

The following detailed protocol ensures optimal reconstitution and validation of recombinant Xenopus laevis pteg:

Reconstitution Protocol:

  • Store lyophilized pteg protein at -20°C to -80°C until ready for use

  • Briefly centrifuge the vial to collect all material at the bottom

  • Reconstitute in sterile deionized water to 0.1-1.0 mg/mL

  • Gently mix by rotating the vial until completely dissolved (avoid vigorous vortexing)

  • For long-term storage, add glycerol to a final concentration of 5-50% (typically 50%)

  • Aliquot to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week; store remaining aliquots at -20°C to -80°C

Validation Assays:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (should show >90% purity)

    • Western blot using anti-His antibodies or specific anti-pteg antibodies

  • Structural integrity:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure

    • Dynamic light scattering (DLS) to assess aggregation state

  • Functional validation:

    • Binding assays with known interaction partners

    • Activity assays specific to pteg function (if established)

When analyzing pteg by SDS-PAGE, researchers should be aware that like other Xenopus proteins, it might display anomalous migration patterns. This has been observed with X b5, which migrates at approximately 25 kDa despite having a predicted mass of 17 kDa due to SDS- and reduction-resistant structural features .

How can researchers troubleshoot common issues in Xenopus laevis transgenic experiments involving pteg?

Researchers working with Xenopus laevis transgenic models for pteg studies should be prepared to address these common challenges:

Low transgene expression:

  • Problem: Weak or undetectable expression of pteg transgenes

  • Solutions:

    • Optimize promoter choice (consider using the strong Ef-1α promoter)

    • Increase transgene concentration (typically 15 ng in 10μL volume)

    • Screen more embryos, as expression can be variable

    • Consider using enhancer elements specific to the tissue of interest

Mosaic expression patterns:

  • Problem: Inconsistent expression between different cells/tissues

  • Solutions:

    • Use the REMI method for integration prior to fertilization

    • Optimize restriction enzyme concentration in the injection mix

    • Consider early injections (single-cell stage) for uniform distribution

Developmental abnormalities:

  • Problem: Transgenic embryos show developmental defects

  • Solutions:

    • Reduce transgene concentration

    • Use inducible expression systems

    • Create tissue-specific constructs to avoid systemic effects

    • Screen for lines with normal development but adequate expression

Transgene silencing:

  • Problem: Expression decreases or disappears over time

  • Solutions:

    • Include insulator elements in constructs

    • Use site-specific integration approaches

    • Monitor expression over multiple generations

    • Consider isogenetic Xenopus clones for consistent genetic background

Troubleshooting table for transgenic screening:

IssuePossible CauseSolution Strategy
No fluorescenceFailed integrationOptimize REMI protocol; increase DNA concentration
High embryo mortalityToxicity of constructReduce DNA concentration; purify DNA thoroughly
Inconsistent resultsVariable integration sitesUse site-specific integration; screen more embryos
Expression in wrong tissuesPromoter leakinessUse more specific promoters; include repressor elements
Weak signalLow expression levelsUse stronger promoters; optimize detection methods

When using the "Sleeping Beauty" transposase system, co-injection of approximately 102 ng of transposase mRNA along with the transgene construct has been shown to be effective for generating transgenic Xenopus laevis embryos .

What experimental design considerations are important for comparative studies between Xenopus and mammalian pteg?

When designing comparative studies between Xenopus and mammalian pteg, researchers should consider these key experimental design factors:

Sequence and structural homology analysis:

  • Perform comprehensive sequence alignments to identify conserved domains

  • Create chimeric constructs combining domains from different species to map functional regions

  • Use structural prediction algorithms to identify potential species-specific features

  • Consider potential differences in post-translational modifications

Expression system selection:

  • Express both proteins in the same system for direct comparison

  • Consider species-specific codon optimization for bacterial expression

  • For mammalian proteins, consider using Xenopus oocyte expression systems for functional studies

  • Include appropriate tags that don't interfere with function

Functional assay standardization:

  • Develop equivalent assays for both proteins under identical conditions

  • Control for differences in optimal temperature (37°C for mammals vs. ~20°C for Xenopus)

  • Use internal controls relevant to each species

  • Consider evolutionary adaptations in interpreting results

Controls for comparative studies:

  • Include positive controls for each species

  • Use chimeric proteins as intermediate references

  • Include evolutionary distant proteins as negative controls

  • Perform parallel assays in both Xenopus and mammalian cellular contexts

Technical considerations:

  • Be aware of potentially misleading differences in electrophoretic mobility, as seen with other Xenopus proteins like cytochrome b5

  • Mass spectrometry and proteolysis studies may be necessary to confirm protein identity when unexpected migration patterns occur

  • Consider the impact of buffer conditions on protein behavior, as optimal conditions may differ between species

What emerging technologies show promise for advancing pteg research in Xenopus laevis?

Several cutting-edge technologies are poised to significantly advance pteg research in Xenopus laevis:

Advanced genome editing technologies:

  • Base editing for precise nucleotide modifications in pteg without double-strand breaks

  • Prime editing for targeted insertions and deletions with minimal off-target effects

  • Multiplexed CRISPR screens to identify genetic interactions with pteg

  • Inducible CRISPR systems for temporal control of gene editing

Single-cell technologies:

  • Single-cell RNA-seq to map pteg expression in specific cell populations during development

  • Single-cell proteomics to quantify pteg protein levels across different cell types

  • Single-cell ATAC-seq to identify regulatory elements controlling pteg expression

  • Spatial transcriptomics to visualize pteg expression patterns in tissue context

Advanced imaging approaches:

  • Lattice light-sheet microscopy for 3D visualization of pteg dynamics in live embryos

  • Super-resolution microscopy for nanoscale localization within proximal tubule cells

  • Multiplexed protein imaging for simultaneous visualization of pteg and interacting partners

  • Correlative light and electron microscopy to link protein localization with ultrastructure

Innovative functional genomics:

  • Synthetic genetic array analysis to map genetic interactions

  • Optogenetic control of pteg activity for precise temporal manipulation

  • Microfluidic organ-on-chip models of Xenopus proximal tubules

  • AI-driven protein structure prediction for pteg and its complexes

These emerging technologies will help address fundamental questions about pteg function while leveraging the unique advantages of the Xenopus model system, such as external development, large embryo size, and well-established transgenic methodologies .

How can pteg research in Xenopus laevis inform human kidney disease mechanisms?

Research on pteg in Xenopus laevis has significant translational potential for understanding human kidney disease mechanisms:

Evolutionary conservation of kidney function:

  • Many proximal tubule transport mechanisms are conserved from amphibians to mammals

  • Similar molecular machinery regulates epithelial polarization and function

  • Developmental pathways governing nephron formation share common elements

  • Conservation of protein-protein interaction networks involving pteg homologs

Advantages of Xenopus as a model for kidney disease:

  • Rapid development of functional pronephric kidneys

  • External development allowing easy manipulation and observation

  • Simplified functional unit for studying basic mechanisms

  • Established transgenic technologies for targeted genetic modifications

Translational research strategies:

  • Model human disease mutations in Xenopus pteg and study functional consequences

  • Screen for compounds that modulate pteg function in Xenopus embryos as potential therapeutics

  • Use comparative approaches to identify species-specific adaptations that could inform therapeutic strategies

  • Develop high-throughput phenotypic screens in Xenopus embryos to identify modifiers of pteg function

Potential applications to human diseases:

Human DiseaseRelevant Proximal Tubule FunctionXenopus Model Contribution
Renal Fanconi syndromeMultiple transport defectsDissection of individual transport pathways
Dent diseaseEndocytic pathway defectsVisualization of protein trafficking
Renal tubular acidosispH regulationStudy of acid-base transport mechanisms
Drug-induced nephrotoxicityXenobiotic transportToxicity screening platforms

By combining the genetic tractability and experimental accessibility of Xenopus with comparative analysis of pteg function across species, researchers can gain insights into fundamental mechanisms of proximal tubule physiology and pathophysiology relevant to human kidney diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.