Species: The protein is derived from Xenopus laevis, a species commonly used in biological research.
Uniprot Number: Q6XQ84.
Tag Information: The tag type is determined during the production process.
Storage Buffer: Tris-based buffer with 50% glycerol, optimized for this protein.
Storage Conditions: Store at -20°C for short-term storage or -80°C for extended storage. Repeated freezing and thawing is not recommended.
Amino Acid Sequence: The sequence begins with MFSLQHVLLILISLGQVYSQQVHHNAGRKFPQWLTGLIAMTVFLFLVLVVYVAKMFWDKR SQESINMKDIEEVVANGTSECCEARKENQYISCNMKDLRSSEHIHAYENPIEVNDNVRST AM.
Protein Names: Recommended name is Proximal Tubules-Expressed Gene Protein, with alternative names including MAP17-like protein and PDZK1-interacting protein 1-like.
Gene Name: pteg.
Expression Region: The full-length protein is expressed from amino acids 1 to 122.
While specific research findings on the biological functions of the Proximal Tubules-Expressed Gene Protein (pteg) are scarce, recombinant proteins like pteg are often used in research for studying protein interactions, signaling pathways, and potential therapeutic applications. The use of Xenopus laevis as a model organism is common due to its well-understood developmental biology and ease of manipulation.
| Characteristic | Description |
|---|---|
| Species | Xenopus laevis |
| Uniprot Number | Q6XQ84 |
| Tag Information | Determined during production |
| Storage Buffer | Tris-based with 50% glycerol |
| Storage Conditions | -20°C or -80°C |
| Amino Acid Sequence | Begins with MFSLQHVLLILISLGQVYSQQVHHNAGRKFPQWLTGLIAMTVFLFLVLVVYVAKMFWDKR SQESINMKDIEEVVANGTSECCEARKENQYISCNMKDLRSSEHIHAYENPIEVNDNVRST AM |
| Protein Names | Proximal Tubules-Expressed Gene Protein, MAP17-like protein, PDZK1-interacting protein 1-like |
| Gene Name | pteg |
| Expression Region | Amino acids 1-122 |
Given the limited information available on the Proximal Tubules-Expressed Gene Protein (pteg), future research should focus on elucidating its biological functions, potential interactions with other proteins, and its role in kidney physiology. Additionally, exploring its potential applications in biomedical research or therapeutic development could provide valuable insights into its utility beyond basic research.
KEGG: xla:445820
UniGene: Xl.34969
Xenopus laevis Proximal tubules-expressed gene protein (pteg) is a 122-amino acid protein primarily expressed in the proximal tubules of Xenopus kidneys. It is also known by several synonyms including Xpteg, MAP17-like protein, and PDZK1-interacting protein 1-like . This protein belongs to a family of small membrane-associated proteins that play roles in epithelial cell function and transport processes. Pteg has structural and functional similarities to mammalian MAP17 proteins, which are involved in protein-protein interactions through PDZ domains and may participate in transmembrane transport processes.
Recombinant Xenopus laevis pteg is typically expressed in E. coli expression systems using vectors that incorporate an N-terminal His-tag for purification purposes . The expression process generally follows these steps:
Cloning of the pteg coding sequence into an appropriate expression vector, such as pT7-based vectors similar to those used for other Xenopus proteins
Transformation of the construct into a suitable E. coli strain (such as Rosetta, which enhances expression of eukaryotic proteins by supplying tRNAs for rare codons)
Induction of protein expression with IPTG under optimized temperature and duration conditions
Cell lysis using sonication or mechanical disruption
Purification via nickel affinity chromatography utilizing the His-tag
Further purification steps may include size exclusion chromatography and ion-exchange chromatography
Confirmation of purity by SDS-PAGE analysis, showing greater than 90% purity
The recombinant protein is typically lyophilized for storage stability, and purity is assessed using SDS-PAGE techniques to ensure quality control for downstream applications .
Optimal storage and reconstitution conditions for recombinant Xenopus laevis pteg are critical for maintaining protein stability and functionality:
Storage conditions:
Store lyophilized powder at -20°C to -80°C upon receipt
Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles
Working aliquots can be stored at 4°C for up to one week
Long-term storage requires -20°C to -80°C with the addition of 5-50% glycerol (standard is 50%)
Reconstitution protocol:
Briefly centrifuge the vial prior to opening to bring contents to the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% for long-term storage
The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0
Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. For research applications requiring consistent results, it is advisable to use freshly reconstituted protein or aliquots that have undergone minimal freeze-thaw cycles.
Several experimental systems are available for studying Xenopus laevis pteg function, each with specific advantages for different research questions:
In vitro systems:
Recombinant protein-based assays utilizing purified His-tagged pteg
Cell-free translation systems using Xenopus egg extracts
Cell culture systems (including Xenopus A6 kidney cells)
Ex vivo systems:
Isolated Xenopus oocytes for protein expression and functional studies
Isolated proximal tubule preparations for transport studies
In vivo systems:
Transgenic Xenopus models using restriction enzyme-mediated insertion (REMI) technology
Transgenic isogenetic Xenopus clones (e.g., LG-6, LG-15) which offer advantages for immunological and developmental studies
CRISPR/Cas9-mediated gene editing in Xenopus embryos
For transgenic approaches, the REMI method has proven particularly effective in Xenopus laevis. This technique involves mixing transgene DNA with purified sperm, restriction enzymes, and egg extract, followed by injection into unfertilized eggs . This allows for correct spatial and temporal regulation of integrated constructs and avoids chimeric embryos, which is an advantage over some other model systems .
Transgenic approaches offer powerful tools for studying pteg expression patterns and functional roles in Xenopus laevis:
Generation of pteg reporter lines:
Create a construct containing the pteg promoter driving expression of a reporter gene (e.g., GFP)
Use REMI technology for integration into the Xenopus genome
The transgene can be integrated into the male genome prior to fertilization, resulting in non-chimeric embryos
Screen larvae for reporter expression using fluorescence microscopy
Monitor spatial and temporal expression patterns during development
Functional studies using overexpression or knockdown:
Overexpression can be achieved using constitutive or inducible promoters
For the "Sleeping Beauty" transposase system, dejellied eggs can be co-injected with transposase mRNA and a vector containing the pteg gene under control of a suitable promoter
Expression can be confirmed by fluorescence microscopy at pre-metamorphic stages (approximately stage 56, 1 month old)
Advantages of Xenopus transgenic systems:
Large-scale transgenesis is possible in Xenopus laevis embryos
Correct spatial and temporal regulation of integrated promoter constructs
Non-chimeric embryos eliminate the need for breeding to obtain non-mosaic animals
Transparent embryos allow for direct visualization of reporter gene expression
It should be noted that exchange of genetic material between male and female genomes and multiple gene insertions have been observed in some cases, which should be considered when interpreting results .
Working with recombinant Xenopus proteins presents several technical challenges that researchers should anticipate:
Expression system challenges:
Codon bias differences between Xenopus and bacterial expression systems may reduce expression efficiency
Post-translational modifications present in Xenopus may be absent in bacterial systems
Membrane proteins like pteg may form inclusion bodies in bacterial expression systems
Structural and biochemical challenges:
Xenopus proteins can exhibit unexpected electrophoretic mobility on SDS-PAGE, as observed with X b5 which migrates at ~25 kDa despite a predicted mass of 17 kDa
SDS- and reduction-resistant structural features may complicate analysis
Confirmation of correct folding and function requires specialized assays
Purification challenges:
| Challenge | Solution Strategy |
|---|---|
| Low solubility | Optimize buffer conditions; use solubility tags |
| Aggregation | Include stabilizing agents (e.g., trehalose) |
| Loss of function during purification | Gentle purification methods; maintain reducing conditions |
| Contaminants with similar properties | Multi-step purification strategies |
Reconstitution and stability issues:
Proper reconstitution is critical for activity (recommended in deionized sterile water to 0.1-1.0 mg/mL)
Addition of 5-50% glycerol helps maintain stability during storage
Working aliquots should be stored at 4°C and used within one week
Avoid repeated freeze-thaw cycles which can reduce protein activity
These challenges require careful optimization of protocols and validation of protein quality before proceeding to functional studies.
Designing comprehensive protein-protein interaction studies for Xenopus laevis pteg requires multiple complementary approaches:
In vitro interaction assays:
Pull-down assays: Using His-tagged recombinant pteg as bait to identify interacting partners from Xenopus tissue lysates
Surface Plasmon Resonance (SPR): For quantitative binding kinetics measurements between pteg and candidate interacting proteins
Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding
Yeast two-hybrid screening: Using pteg as bait against Xenopus cDNA libraries
Cellular interaction assays:
Co-immunoprecipitation: From Xenopus tissues or cells expressing tagged pteg
Proximity Labeling: Using BioID or APEX2 fusions to identify proteins in close proximity to pteg in living cells
Fluorescence Resonance Energy Transfer (FRET): For studying interactions in live cells using fluorescently tagged proteins
Validation and functional characterization:
Domain mapping: Creating truncation mutants to identify interaction domains
Competitive binding assays: To determine binding specificity
Functional assays: Assessing how interactions affect pteg function in proximal tubule cells
Given that pteg is a putative PDZK1-interacting protein, special attention should be paid to PDZ domain interactions. Similar to approaches used with other Xenopus proteins, chimeric constructs combining domains from human and Xenopus proteins can help identify species-specific interaction determinants .
To elucidate pteg's role in proximal tubule function, researchers can employ several specialized methodologies:
Ex vivo tubule transport studies:
Isolate proximal tubule segments from Xenopus laevis kidneys
Perfuse isolated tubules with fluorescent substrates
Measure transport rates in the presence of pteg inhibitors or in tubules from transgenic animals with modified pteg expression
Use video-enhanced DIC microscopy to observe structural changes
Electrophysiological approaches:
Patch-clamp recordings of proximal tubule cells to measure ion channel activity
Two-electrode voltage clamp in Xenopus oocytes expressing pteg and potential partner proteins
Transepithelial electrical measurements in polarized cell cultures
Cellular localization studies:
Immunohistochemistry with anti-pteg antibodies in kidney sections
Live cell imaging using fluorescently tagged pteg in Xenopus cell lines
Electron microscopy to determine subcellular localization with nanometer resolution
Functional genomics approaches:
CRISPR/Cas9-mediated gene editing to create pteg knockouts
RNA-seq analysis of proximal tubule cells with modulated pteg expression
Metabolomic analysis to identify changes in small molecule transport
Xenopus embryonic kidney development model:
The development of pronephric tubules in Xenopus embryos provides an accessible model for studying pteg's role in kidney development and function
Transgenic approaches using the REMI method allow visualization of pteg expression during tubule formation
Time-lapse imaging of fluorescently labeled pteg can reveal dynamic changes during tubulogenesis
Comparative analysis of pteg across species reveals important evolutionary and functional insights:
Structural comparisons:
The 122-amino acid Xenopus laevis pteg shares structural features with mammalian MAP17 proteins
Like other Xenopus proteins such as cytochrome b5 (b5), pteg may display unusual electrophoretic mobility properties that differ from mammalian homologs
Sequence alignment reveals conserved transmembrane domains and potential PDZ-binding motifs
Functional comparisons:
Xenopus pteg, like mammalian MAP17, is likely involved in epithelial transport processes
Species-specific differences in protein-protein interactions may exist, similar to observations with other Xenopus proteins like cytochrome b5, which shows differential interaction patterns compared to human homologs
Evolutionary adaptations:
Amphibian-specific features of pteg may reflect adaptations to different osmotic environments
Kidney proximal tubule functions have evolved different regulatory mechanisms across vertebrate species
Comparative protein expression systems:
When designing experiments involving pteg across species, researchers should consider these differences, particularly in protein-protein interaction studies where species-specific interfaces may exist. Chimeric constructs, such as those developed for cytochrome b5 studies combining human and Xenopus domains , can be valuable tools for mapping functional conservation and divergence.
Studying pteg in Xenopus developmental contexts requires specialized approaches that take advantage of the unique features of this model system:
Temporal expression profiling:
Quantitative RT-PCR at different developmental stages
Western blotting of stage-specific embryo lysates
In situ hybridization to visualize spatial expression patterns during development
Single-cell RNA-seq to identify cell populations expressing pteg during organogenesis
Functional perturbation strategies:
Morpholino oligonucleotides for targeted knockdown in early development
CRISPR/Cas9 gene editing for generating knockout or knock-in lines
Inducible transgene expression using heat shock or chemical inducers
Targeted protein degradation approaches (e.g., auxin-inducible degron systems)
Transgenic reporter systems:
REMI method for generating transgenic Xenopus embryos with pteg-reporter constructs
"Sleeping Beauty" transposase system for efficient transgene integration
Dual fluorescent reporter systems for simultaneous visualization of pteg and interacting proteins
Live imaging techniques:
Light sheet microscopy for whole-embryo imaging of pteg-GFP expression
Confocal time-lapse microscopy for cellular dynamics studies
Super-resolution microscopy for subcellular localization during tubulogenesis
One of the significant advantages of using Xenopus for developmental studies is that transgenesis using the REMI method allows integration of the transgene into the male genome prior to fertilization, resulting in non-chimeric embryos that show correct spatial and temporal regulation of integrated constructs . This eliminates the need for breeding animals to obtain non-mosaic lines, accelerating the research timeline.
The following detailed protocol ensures optimal reconstitution and validation of recombinant Xenopus laevis pteg:
Reconstitution Protocol:
Store lyophilized pteg protein at -20°C to -80°C until ready for use
Briefly centrifuge the vial to collect all material at the bottom
Reconstitute in sterile deionized water to 0.1-1.0 mg/mL
Gently mix by rotating the vial until completely dissolved (avoid vigorous vortexing)
For long-term storage, add glycerol to a final concentration of 5-50% (typically 50%)
Aliquot to minimize freeze-thaw cycles
Store working aliquots at 4°C for up to one week; store remaining aliquots at -20°C to -80°C
Validation Assays:
Purity assessment:
Structural integrity:
Circular dichroism (CD) spectroscopy to confirm secondary structure
Dynamic light scattering (DLS) to assess aggregation state
Functional validation:
Binding assays with known interaction partners
Activity assays specific to pteg function (if established)
When analyzing pteg by SDS-PAGE, researchers should be aware that like other Xenopus proteins, it might display anomalous migration patterns. This has been observed with X b5, which migrates at approximately 25 kDa despite having a predicted mass of 17 kDa due to SDS- and reduction-resistant structural features .
Researchers working with Xenopus laevis transgenic models for pteg studies should be prepared to address these common challenges:
Low transgene expression:
Problem: Weak or undetectable expression of pteg transgenes
Solutions:
Mosaic expression patterns:
Problem: Inconsistent expression between different cells/tissues
Solutions:
Developmental abnormalities:
Problem: Transgenic embryos show developmental defects
Solutions:
Reduce transgene concentration
Use inducible expression systems
Create tissue-specific constructs to avoid systemic effects
Screen for lines with normal development but adequate expression
Transgene silencing:
Problem: Expression decreases or disappears over time
Solutions:
Troubleshooting table for transgenic screening:
| Issue | Possible Cause | Solution Strategy |
|---|---|---|
| No fluorescence | Failed integration | Optimize REMI protocol; increase DNA concentration |
| High embryo mortality | Toxicity of construct | Reduce DNA concentration; purify DNA thoroughly |
| Inconsistent results | Variable integration sites | Use site-specific integration; screen more embryos |
| Expression in wrong tissues | Promoter leakiness | Use more specific promoters; include repressor elements |
| Weak signal | Low expression levels | Use stronger promoters; optimize detection methods |
When using the "Sleeping Beauty" transposase system, co-injection of approximately 102 ng of transposase mRNA along with the transgene construct has been shown to be effective for generating transgenic Xenopus laevis embryos .
When designing comparative studies between Xenopus and mammalian pteg, researchers should consider these key experimental design factors:
Sequence and structural homology analysis:
Perform comprehensive sequence alignments to identify conserved domains
Create chimeric constructs combining domains from different species to map functional regions
Use structural prediction algorithms to identify potential species-specific features
Consider potential differences in post-translational modifications
Expression system selection:
Express both proteins in the same system for direct comparison
Consider species-specific codon optimization for bacterial expression
For mammalian proteins, consider using Xenopus oocyte expression systems for functional studies
Include appropriate tags that don't interfere with function
Functional assay standardization:
Develop equivalent assays for both proteins under identical conditions
Control for differences in optimal temperature (37°C for mammals vs. ~20°C for Xenopus)
Use internal controls relevant to each species
Consider evolutionary adaptations in interpreting results
Controls for comparative studies:
Include positive controls for each species
Use chimeric proteins as intermediate references
Include evolutionary distant proteins as negative controls
Perform parallel assays in both Xenopus and mammalian cellular contexts
Technical considerations:
Be aware of potentially misleading differences in electrophoretic mobility, as seen with other Xenopus proteins like cytochrome b5
Mass spectrometry and proteolysis studies may be necessary to confirm protein identity when unexpected migration patterns occur
Consider the impact of buffer conditions on protein behavior, as optimal conditions may differ between species
Several cutting-edge technologies are poised to significantly advance pteg research in Xenopus laevis:
Advanced genome editing technologies:
Base editing for precise nucleotide modifications in pteg without double-strand breaks
Prime editing for targeted insertions and deletions with minimal off-target effects
Multiplexed CRISPR screens to identify genetic interactions with pteg
Inducible CRISPR systems for temporal control of gene editing
Single-cell technologies:
Single-cell RNA-seq to map pteg expression in specific cell populations during development
Single-cell proteomics to quantify pteg protein levels across different cell types
Single-cell ATAC-seq to identify regulatory elements controlling pteg expression
Spatial transcriptomics to visualize pteg expression patterns in tissue context
Advanced imaging approaches:
Lattice light-sheet microscopy for 3D visualization of pteg dynamics in live embryos
Super-resolution microscopy for nanoscale localization within proximal tubule cells
Multiplexed protein imaging for simultaneous visualization of pteg and interacting partners
Correlative light and electron microscopy to link protein localization with ultrastructure
Innovative functional genomics:
Synthetic genetic array analysis to map genetic interactions
Optogenetic control of pteg activity for precise temporal manipulation
Microfluidic organ-on-chip models of Xenopus proximal tubules
AI-driven protein structure prediction for pteg and its complexes
These emerging technologies will help address fundamental questions about pteg function while leveraging the unique advantages of the Xenopus model system, such as external development, large embryo size, and well-established transgenic methodologies .
Research on pteg in Xenopus laevis has significant translational potential for understanding human kidney disease mechanisms:
Evolutionary conservation of kidney function:
Many proximal tubule transport mechanisms are conserved from amphibians to mammals
Similar molecular machinery regulates epithelial polarization and function
Developmental pathways governing nephron formation share common elements
Conservation of protein-protein interaction networks involving pteg homologs
Advantages of Xenopus as a model for kidney disease:
Rapid development of functional pronephric kidneys
External development allowing easy manipulation and observation
Simplified functional unit for studying basic mechanisms
Established transgenic technologies for targeted genetic modifications
Translational research strategies:
Model human disease mutations in Xenopus pteg and study functional consequences
Screen for compounds that modulate pteg function in Xenopus embryos as potential therapeutics
Use comparative approaches to identify species-specific adaptations that could inform therapeutic strategies
Develop high-throughput phenotypic screens in Xenopus embryos to identify modifiers of pteg function
Potential applications to human diseases:
| Human Disease | Relevant Proximal Tubule Function | Xenopus Model Contribution |
|---|---|---|
| Renal Fanconi syndrome | Multiple transport defects | Dissection of individual transport pathways |
| Dent disease | Endocytic pathway defects | Visualization of protein trafficking |
| Renal tubular acidosis | pH regulation | Study of acid-base transport mechanisms |
| Drug-induced nephrotoxicity | Xenobiotic transport | Toxicity screening platforms |
By combining the genetic tractability and experimental accessibility of Xenopus with comparative analysis of pteg function across species, researchers can gain insights into fundamental mechanisms of proximal tubule physiology and pathophysiology relevant to human kidney diseases.