Recombinant Xenopus laevis Putative ferric-chelate reductase 1 (frrs1)

What is Xenopus laevis Putative ferric-chelate reductase 1 (frrs1) and how is it related to the FRRS1L protein found in humans?

Xenopus laevis Putative ferric-chelate reductase 1 (frrs1) is a protein involved in iron metabolism that shares homology with the human FRRS1L protein. While frrs1 functions primarily in iron reduction and transport, its homolog FRRS1L has evolved specialized functions in humans, particularly in relation to AMPA receptor biogenesis in the brain. Loss-of-function mutations in human FRRS1L are associated with severe neurological conditions including choreoathetosis, cognitive deficits, and epileptic encephalopathies . The evolutionary relationship between these proteins highlights the divergence of function across species while maintaining structural similarities.

How does the amino acid sequence of Xenopus laevis frrs1 compare to related proteins like cybrd1?

While frrs1 and cybrd1 (Cytochrome b reductase 1) are both involved in iron metabolism, they have distinct amino acid sequences that reflect their specific functions. For comparison, the full-length Xenopus laevis cybrd1 protein consists of 283 amino acids with the sequence: MEGYKSFLAFLVSSLLLGFLGVIFTLVWVLHWREGLGWDGGAAEFNWHPVLVTSGFIFIQGIAIIVYRLPWTWKCSKLLMKFIHAGLHLTALIFTIVALVAVFDFHNAKNIPNMYSLHSWIGLTV VILYALQLVLGVSIYLLPFASNTLRAALMPVHVYSGLFIFGTVIATALMGITEKLIFSLKEPPYSKLPPEAIFVNTFGLLILVFGGLVVWMVTTPAWKRPREQGMEILSPTVSSP DETEEGSTITDCSNTEKSDVELNSEAARKRILKLDEAGQRSTM . Structural analysis indicates that both proteins contain transmembrane domains required for their localization and function at cellular membranes.

What developmental expression pattern does frrs1 exhibit in Xenopus laevis embryos?

Based on expression patterns of related proteins in Xenopus laevis, frrs1 likely follows a developmentally regulated expression profile. For context, other functionally important Xenopus proteins such as FBRSL1 show maternal expression detected in the animal pole at early stages, followed by broad expression during gastrulation (with the exception of the blastoporus), and more localized expression in the anterior neural plate during neurulation . By understanding the temporal and spatial expression pattern of frrs1, researchers can gain insights into its potential developmental roles.

What are the optimal conditions for expressing and purifying recombinant Xenopus laevis frrs1 protein in E. coli systems?

For optimal expression of recombinant Xenopus laevis frrs1 in E. coli, researchers should consider using a system similar to that employed for related proteins. Based on protocols for similar proteins, expression in E. coli with an N-terminal His tag provides good yields of functional protein . The optimal procedure includes:

• Cloning the full-length coding sequence into an expression vector with an N-terminal His tag

• Transforming into an E. coli strain optimized for protein expression (BL21(DE3) or similar)

• Inducing expression at OD600 0.6-0.8 with 0.5-1mM IPTG

• Growing cultures at 16-18°C overnight to minimize inclusion body formation

• Purifying using Ni-NTA affinity chromatography under native conditions

For storage, the purified protein should be buffer-exchanged into Tris/PBS-based buffer with 6% trehalose at pH 8.0, aliquoted and stored at -20°C/-80°C to prevent repeated freeze-thaw cycles that could compromise protein activity .

How can researchers validate the functional activity of recombinant frrs1 protein after purification?

To validate functional activity of recombinant frrs1 protein, researchers should implement a multi-step validation approach:

• Structural integrity assessment: Perform SDS-PAGE analysis to confirm >90% purity and correct molecular weight

• Iron reduction assay: Measure ferric iron (Fe³⁺) to ferrous iron (Fe²⁺) conversion using ferrozine-based colorimetric assays

• Binding assays: Analyze interaction with potential physiological partners using co-immunoprecipitation or surface plasmon resonance

• Enzymatic kinetics: Determine Km and Vmax values for iron reduction under varying substrate concentrations and pH conditions

For accurate results, researchers should conduct these assays with appropriate positive controls (such as commercial ferric reductases) and negative controls (heat-inactivated protein).

What morpholino design strategies are most effective for studying frrs1 function in Xenopus embryos?

Based on successful approaches with related proteins like FBRSL1, effective morpholino design for studying frrs1 should include both translation-blocking and splice-blocking approaches:

• Translation-blocking morpholino (tb MO): Design targeting the region spanning the start codon and approximately 25 nucleotides downstream or upstream. Validation should include western blot analysis to confirm protein knockdown .

• Splice-blocking morpholino (sp MO): Target exon-intron boundaries (particularly exon 1/intron 1) to induce inclusion of intronic sequences with premature stop codons, resulting in protein truncation. Validation requires RT-PCR to confirm altered splicing patterns .

For maximum specificity, researchers should:

• Include control morpholinos with 5 mismatched nucleotides

• Perform rescue experiments using co-injection of morpholino-resistant mRNA

• Use multiple independent morpholinos targeting different regions to confirm specificity of phenotypes

What is the proposed role of frrs1 in iron metabolism during Xenopus development?

The putative ferric-chelate reductase activity of frrs1 suggests a crucial role in iron metabolism during Xenopus development, particularly in tissues with high iron demands. Similar to mammalian iron metabolism pathways, frrs1 likely facilitates the reduction of ferric iron (Fe³⁺) to ferrous iron (Fe²⁺), making it available for cellular uptake via divalent metal transporters. This process is particularly important in rapidly developing embryos where iron is essential for:

• Oxygen transport and hemoglobin synthesis

• Energy metabolism through iron-containing enzymes

• Neuronal development and myelination

• Muscle development and function

Developmental studies of related proteins in Xenopus reveal critical periods where iron metabolism genes show dynamic expression patterns, suggesting frrs1 may have stage-specific roles during embryogenesis that warrant further investigation.

How might frrs1 function differ from its homolog FRRS1L in relation to neurological development?

While FRRS1L in mammals has evolved specialized functions in AMPA receptor regulation in the nervous system, Xenopus laevis frrs1 likely maintains more conserved roles in iron metabolism. This functional divergence represents an interesting evolutionary adaptation:

FRRS1L knockout mice exhibit specific neurological phenotypes including hyperactivity, working memory deficits, and sleep fragmentation along with reduced AMPA receptor levels in the brain . In contrast, frrs1 disruption in Xenopus would be predicted to cause broader developmental abnormalities related to iron availability rather than specific neurological deficits.

What experimental evidence suggests potential roles for frrs1 in non-iron related cellular processes?

While frrs1's primary function relates to iron metabolism, several lines of evidence from related proteins suggest potential moonlighting functions:

• Protein-protein interactions: Analysis of interacting partners may reveal connections to signaling pathways beyond iron metabolism

• Transcriptional regulation: Potential involvement in gene expression regulation through iron-dependent transcription factors

• Cellular stress responses: Possible role in oxidative stress management through regulation of free iron levels

• Membrane organization: Structural contributions to membrane microdomains based on its transmembrane nature

Research on related proteins like FRRS1L demonstrates how proteins can evolve specialized functions beyond their ancestral roles. FRRS1L, for example, has specialized to regulate AMPA receptor biogenesis despite its structural similarity to iron metabolism proteins . This suggests frrs1 may likewise have evolved secondary functions in Xenopus that warrant investigation.

How can CRISPR-Cas9 genome editing be optimized for studying frrs1 function in Xenopus laevis, considering its pseudotetraploid genome?

Designing effective CRISPR-Cas9 strategies for frrs1 in Xenopus laevis requires addressing the challenges posed by its pseudotetraploid genome:

• Homeolog identification and targeting:

  • Identify both L and S homeologs of frrs1 (from long and short chromosomes)

  • Design sgRNAs targeting conserved regions in both homeologs

  • Use T7 endonuclease I assay to verify cutting efficiency in vitro before embryo injection

• Delivery optimization:

  • Inject Cas9 protein (not mRNA) with sgRNAs at the one-cell stage for maximum distribution

  • Use nuclear localization signal (NLS)-tagged Cas9 for improved nuclear targeting

  • Titrate sgRNA:Cas9 ratios (3:1 to 5:1) to minimize off-target effects

• Mutation verification:

  • Design PCR primers outside the target region for both homeologs

  • Perform deep sequencing to quantify mutation rates in each homeolog

  • Analyze F0 embryos for mosaic mutations before breeding F1 generation

This approach allows for comprehensive functional analysis that accounts for potential compensatory effects between homeologs in this pseudotetraploid model organism.

What are the most effective approaches for investigating potential interactions between frrs1 and AMPA receptors in Xenopus neural tissues?

To investigate whether frrs1 shares any functional relationship with AMPA receptors similar to its mammalian homolog FRRS1L, researchers should employ multiple complementary approaches:

• Co-immunoprecipitation and proximity labeling:

  • Use anti-frrs1 antibodies to pull down associated proteins from Xenopus neural tissues

  • Employ BioID or APEX2 proximity labeling with frrs1 as bait to identify transient interactors

  • Analyze results specifically for AMPA receptor subunits and associated proteins

• Electrophysiological assessment:

  • Perform whole-cell patch-clamp recordings in frrs1-depleted neurons

  • Assess AMPA receptor-mediated currents using specific agonists

  • Compare results with FRRS1L-deficient mammalian neurons as reference

• Subcellular localization studies:

  • Use fluorescently tagged frrs1 to determine if it localizes to ER compartments involved in AMPA receptor assembly

  • Perform immunofluorescence co-localization with AMPA receptor subunits during different developmental stages

These approaches would help determine whether the role of FRRS1L in AMPA receptor regulation represents an evolutionary innovation specific to mammals or a conserved function present in amphibians.

How can transcriptomic and proteomic analyses be integrated to understand the regulatory networks involving frrs1 during Xenopus development?

An integrated multi-omics approach can provide comprehensive insights into frrs1 regulatory networks:

• Developmental transcriptomics workflow:

  • Perform RNA-seq across key developmental stages (fertilized egg to tadpole)

  • Create temporal expression profiles for frrs1 and co-regulated genes

  • Identify transcription factors potentially regulating frrs1 expression

  • Compare with expression patterns of genes involved in iron metabolism and AMPA receptor function

• Targeted proteomics approach:

  • Implement parallel reaction monitoring (PRM) to quantify frrs1 protein levels

  • Analyze post-translational modifications using phosphoproteomics

  • Track protein half-life and turnover using pulse-chase proteomics

• Integrated analysis framework:

  • Correlate frrs1 expression with iron-dependent developmental processes

  • Identify discrepancies between transcript and protein levels indicating post-transcriptional regulation

  • Construct protein-protein interaction networks centered on frrs1

By integrating these datasets, researchers can develop testable hypotheses about frrs1 function and regulation in the context of iron metabolism, potential AMPA receptor interactions, and broader developmental processes.

What are the most common challenges in producing active recombinant frrs1 protein and how can they be addressed?

Recombinant production of transmembrane proteins like frrs1 presents several challenges that can be addressed with specific technical approaches:

• Insolubility and inclusion body formation:

  • Lower induction temperature to 16-18°C

  • Reduce IPTG concentration to 0.1-0.2 mM

  • Use specialized E. coli strains (e.g., C41(DE3)) designed for membrane protein expression

  • Include solubility enhancers like sorbitol (0.5-1.0 M) in growth media

• Improper folding and loss of activity:

  • Add metal ions (Fe²⁺, Zn²⁺) to growth media to facilitate correct folding

  • Include reducing agents (1-5 mM β-mercaptoethanol) in buffers

  • Optimize detergent type and concentration for membrane protein solubilization

  • Consider fusion partners (MBP, thioredoxin) to enhance solubility

• Low yield and protein degradation:

  • Optimize codon usage for E. coli expression

  • Include protease inhibitors throughout purification

  • Maintain cold temperatures (4°C) during all purification steps

  • Store in buffer containing 6% trehalose to prevent freeze-thaw damage

For maximum stability during storage, researchers should lyophilize the purified protein or store it at -80°C in small aliquots to prevent repeated freeze-thaw cycles .

How can researchers differentiate between the specific effects of frrs1 knockdown and non-specific morpholino toxicity in Xenopus embryos?

Distinguishing specific phenotypes from non-specific effects requires rigorous experimental design:

• Essential controls:

  • Include standard control morpholinos at equivalent concentrations

  • Perform p53 morpholino co-injection to suppress non-specific apoptosis

  • Establish dose-response relationships to identify specific vs. toxic concentrations

  • Implement rescue experiments with morpholino-resistant mRNA constructs

• Phenotypic validation approaches:

  • Use multiple morpholinos targeting different regions of frrs1 mRNA

  • Confirm knockdown efficiency by western blot or qPCR

  • Compare morphant phenotypes with CRISPR-generated mutants

  • Assess tissue-specific effects using targeted injections

• Molecular signature analysis:

  • Compare transcriptional profiles of frrs1 morphants vs. control morphants

  • Identify iron metabolism-specific gene expression changes

  • Monitor oxidative stress markers that might indicate iron dysregulation

  • Assess markers of general toxicity and cell death

The gold standard for validating morpholino specificity is rescue of the phenotype by co-injection of morpholino-resistant mRNA, as demonstrated effectively with FBRSL1 morphants in Xenopus .

What considerations are important when designing antibodies for detecting endogenous Xenopus laevis frrs1 in immunohistochemistry and western blotting?

Developing effective antibodies for frrs1 detection requires careful epitope selection and validation:

• Epitope selection strategies:

  • Target regions with high antigenicity and surface probability

  • Avoid transmembrane domains and signal peptides

  • Choose regions that differ from related proteins (e.g., cybrd1) to prevent cross-reactivity

  • Select epitopes conserved between L and S homeologs in Xenopus laevis

• Antibody validation requirements:

  • Confirm specificity using recombinant protein positive controls

  • Test on tissues from morpholino-injected or CRISPR-edited embryos as negative controls

  • Verify detection of both homeologs if targeting conserved epitopes

  • Perform peptide competition assays to confirm specificity

• Technical optimizations:

  • For western blotting: Optimize membrane transfer conditions for this transmembrane protein

  • For immunohistochemistry: Test multiple fixation protocols (particularly important for membrane proteins)

  • For both applications: Include detergents appropriate for membrane protein solubilization

  • Test antibody function in both reduced and non-reduced conditions

Using multiple antibodies targeting different epitopes provides the most reliable detection strategy and helps confirm the specificity of observed signals.

How does the function of frrs1 in Xenopus compare to its orthologs in mammals and other vertebrates?

Comparative analysis reveals important functional conservation and divergence across vertebrates:

This evolutionary comparison suggests that while the ancestral function of frrs1 in iron metabolism is likely conserved in Xenopus, mammals have evolved specialized homologs like FRRS1L that have adopted new functions in neuronal signaling . Understanding these evolutionary relationships provides context for interpreting experimental results and extrapolating findings across species.

What insights can be gained from comparing the developmental roles of frrs1 with other iron metabolism proteins in Xenopus embryogenesis?

Comparing frrs1 with other iron-related proteins in Xenopus reveals coordinated regulation of iron homeostasis during development:

• Temporal coordination:

  • Expression of iron acquisition proteins likely precedes utilization proteins

  • Critical developmental windows may exist where iron metabolism is particularly important

  • Comparison with hemoglobin synthesis timing would reveal relationships with erythropoiesis

• Spatial relationships:

  • Tissue-specific expression patterns may indicate specialized iron requirements

  • Co-expression with iron storage proteins in specific tissues suggests functional relationships

  • Differential expression between embryonic and extraembryonic tissues indicates resource allocation priorities

• Functional redundancy:

  • Overlapping expression with cybrd1 may indicate functional redundancy

  • Compensatory regulation when one component is disrupted suggests network robustness

  • Evolutionary conservation indicates essential functions

This comparative approach places frrs1 within the broader context of iron metabolism during development and helps predict the consequences of its disruption.

What emerging technologies could advance our understanding of frrs1 function in Xenopus laevis developmental biology?

Several cutting-edge technologies hold promise for elucidating frrs1 function:

• Single-cell transcriptomics/proteomics:

  • Map frrs1 expression at single-cell resolution across developmental stages

  • Identify cell populations particularly dependent on frrs1 function

  • Discover co-regulated genes within specific cell lineages

• Optogenetic and chemogenetic tools:

  • Develop light-activated or small molecule-regulated frrs1 variants

  • Enable temporal and spatial control of frrs1 activity in vivo

  • Study acute vs. chronic effects of frrs1 disruption

• Cryo-electron microscopy:

  • Determine high-resolution structure of frrs1 protein

  • Identify substrate binding sites and catalytic residues

  • Guide structure-based drug design for targeting human orthologs

• Tissuebound-seq and Ribo-seq:

  • Map tissue-specific translation of frrs1 mRNA during development

  • Identify regulatory elements controlling frrs1 translation

  • Discover potential upstream open reading frames (uORFs) regulating expression

These technologies would address current knowledge gaps and provide unprecedented insights into frrs1 function at molecular, cellular, and organismal levels.

How might understanding frrs1 function in Xenopus contribute to therapeutic approaches for human FRRS1L-related disorders?

Research on Xenopus frrs1 has translational potential for human FRRS1L-related disorders:

• Drug discovery applications:

  • Xenopus embryos provide a medium-throughput screening platform for compounds affecting frrs1/FRRS1L function

  • Identification of small molecules that modulate frrs1 activity could lead to therapeutic candidates

  • Testing compounds that rescue frrs1 morphant phenotypes may identify potential treatments for human disorders

• Gene therapy considerations:

  • Determining which isoforms or domains of frrs1/FRRS1L are sufficient for rescue informs gene therapy approaches

  • Similar to how the short N-terminal isoform I3.1 of human FBRSL1 could rescue fbrsl1 morphant phenotypes , identifying minimal functional domains of FRRS1L could guide therapeutic development

  • Understanding species-specific differences guides appropriate modification of human genes for optimal function

• Biomarker development:

  • Identifying downstream molecular signatures of frrs1 disruption may reveal biomarkers for human FRRS1L disorders

  • Metabolic changes related to iron metabolism could serve as diagnostic indicators

  • Early developmental alterations may provide prognostic indicators

By utilizing Xenopus as a model system, researchers can accelerate understanding of fundamental mechanisms underlying FRRS1L-related disorders and potentially develop novel therapeutic approaches.