Recombinant Xenopus laevis Reprimo-like protein (rprml)

Shipped with Ice Packs
In Stock

Description

Introduction to Reprimo-Like Protein

Reprimo-like protein (RPRML) belongs to the Reprimo gene family, which consists of two related protein-coding and intronless genes: Reprimo (RPRM) and Reprimo-like (RPRML). This gene family, while still poorly characterized, has been implicated in important developmental processes and cancer progression mechanisms . The Reprimo gene family comprises a group of single-exon genes with physiological functions that remain incompletely understood .

Xenopus laevis, commonly known as the African clawed frog, serves as an important model organism in developmental biology research. The recombinant form of X. laevis RPRML has garnered attention for its potential applications in studying protein function and exploring developmental pathways.

Gene Location and Conservation

While the X. laevis RPRML gene location is not specifically detailed in the available research, the human ortholog RPRML is located at chromosome 17q21.32 . The expression pattern of RPRML shows remarkable conservation between species, particularly between zebrafish and humans, suggesting important evolutionarily conserved functions .

The conservation of RPRML across vertebrate species indicates its fundamental biological importance. This conservation allows researchers to study the protein in model organisms like X. laevis and extrapolate findings to understand human biology and disease mechanisms.

Production Methods

Recombinant X. laevis RPRML protein is typically produced in E. coli expression systems . The recombinant protein is commonly generated with an N-terminal His-tag to facilitate purification and detection in experimental settings. This approach allows for the efficient production of functionally active protein for research applications.

Physical and Chemical Properties

The commercially available recombinant X. laevis RPRML protein has the following properties:

PropertySpecification
SourceE. coli expression system
SpeciesXenopus laevis (African clawed frog)
TagHis
Protein LengthFull Length (1-112)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C upon receipt, aliquoting necessary for multiple use

The recombinant protein is typically supplied as a lyophilized powder that requires reconstitution before use. For optimal results, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

Developmental Functions

Research has begun to uncover important developmental roles for RPRML, particularly in hematopoiesis. Studies in zebrafish have demonstrated that RPRML is essential during embryonic development, with a specific role in definitive hematopoiesis .

Cellular Function

At the cellular level, RPRML appears to be involved in regulating apoptosis. Loss of RPRML increases the activity of caspase-3 in endothelial cells within the caudal hematopoietic tissue of zebrafish embryos, which is the first perivascular niche where hematopoietic stem/progenitor cells reside during embryonic development . This suggests that RPRML may protect against inappropriate apoptosis in specific cell populations during development.

In human cells, RPRML has been observed to inhibit cell cycle progression at the G2/M phase when overexpressed in gastric cancer cell lines. This inhibition reduces cell proliferation, clonogenic capacity, and anchorage-independent growth, suggesting a potential tumor suppressor function .

Role in Cancer

Evidence suggests that RPRML may function as a tumor suppressor gene, particularly in gastric cancer. In humans, RPRML protein expression has been detected in the cytoplasm of glandular and foveolar epithelial cells of the stomach . Analyses of gastric tumors show that RPRML expression is significantly downregulated compared to normal adjacent tissues .

This loss of expression is associated with a reduction of the apoptotic marker cleaved caspase-3 and correlates with worse prognosis in patients with advanced stages of gastric cancer . Similar to its homolog RPRM, the silencing of RPRML in gastric cancer appears to be mediated by DNA methylation .

Potential as a Biomarker

The methylation status of RPRML has shown promise as a biomarker in cancer detection. Circulating methylated RPRML DNA in plasma samples has been successfully explored as a non-invasive biomarker for gastric cancer diagnosis . This suggests that RPRML may have clinical utility in cancer diagnostics and monitoring.

Current Research Applications

Recombinant X. laevis RPRML protein has several potential applications in research:

  1. Functional studies to elucidate the protein's role in developmental processes

  2. Investigation of protein-protein interactions to identify binding partners

  3. Generation of antibodies for detection of endogenous RPRML

  4. Structure-function analyses to understand how RPRML exerts its cellular effects

  5. Comparative studies across species to identify conserved functional domains

Future Research Directions

Several areas warrant further investigation:

  1. The molecular mechanisms by which RPRML influences hematopoietic development

  2. The potential role of RPRML in other developmental processes in X. laevis

  3. Comparison of RPRML function across vertebrate species

  4. Exploration of RPRML as a therapeutic target in cancer

  5. Investigation of RPRML's role in signaling pathways, particularly its potential interaction with the Wnt/β-catenin pathway, which has been suggested in colorectal cancer cells

The continued study of X. laevis RPRML through recombinant protein approaches promises to yield valuable insights into fundamental biological processes and potentially inform novel therapeutic strategies for human diseases.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rprml; Reprimo-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rprml
Target Protein Sequence
MNGTFFNHTLMEQVAYNNTTSQDLGSLMGCCNGSQTVITNDGGSLILIPDERSLFITRVV QIAVLCVLSLTVLFGIFFLGCNLLIKSESMINFLVKDRRPSKDVGAVILGLY
Uniprot No.

Target Background

Database Links

KEGG: xla:444584

UniGene: Xl.26514

Protein Families
Reprimo family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Reprimo-like protein (RPRML) and how does it relate to the Reprimo gene family?

Reprimo-like (RPRML) is a vertebrate gene located on human chromosome 17q21.32 and is part of the Reprimo gene family. This family consists of two human-related protein-coding and intronless genes: Reprimo (RPRM) and Reprimo-like (RPRML). The physiological function of this gene family remains poorly understood, though they have been implicated in developmental processes and cancer pathways . While Reprimo (RPRM) has been characterized as a putative p53-dependent tumor suppressor that functions at the G2/M cell cycle checkpoint, RPRML's specific function has only recently begun to be elucidated . Both genes share structural similarities but appear to have distinct functional roles in vertebrate biology.

What is the current understanding of RPRML's role in embryonic development?

RPRML plays a critical role in embryonic development, particularly in hematopoiesis. Studies in zebrafish have demonstrated that RPRML is normally expressed during embryonic development and is essential for proper definitive hematopoiesis . When RPRML expression is disrupted using CRISPR-Cas9 or antisense morpholino oligonucleotides in zebrafish, researchers observed normal formation of hemangioblasts and primitive wave hematopoiesis, but significant impairment in definitive hematopoiesis . Specifically, loss of RPRML leads to a significant reduction in erythroid-myeloid precursors at the posterior blood island and a decline in definitive hematopoietic stem/progenitor cells . Additionally, RPRML expression patterns show conservation between zebrafish and human species, suggesting evolutionary importance in vertebrate development .

How does RPRML function at the molecular level during vertebrate development?

At the molecular level, RPRML appears to regulate apoptotic pathways in developing tissues. Loss of RPRML in zebrafish increases caspase-3 activity in endothelial cells within the caudal hematopoietic tissue, which is the first perivascular niche where hematopoietic stem/progenitor cells reside during zebrafish embryonic development . This suggests that RPRML may normally suppress inappropriate apoptosis in these endothelial cells, thereby maintaining the hematopoietic niche. Although the complete signaling mechanism remains to be fully elucidated, this finding establishes a physiological role for the RPRML gene in hematovascular development, specifically during definitive waves of hematopoiesis .

What expression systems are most effective for producing recombinant Xenopus RPRML?

Based on established protocols for Xenopus protein expression, several systems can be employed for recombinant RPRML production. When working with Xenopus proteins, researchers should consider:

  • Bacterial expression systems: E. coli-based systems can be used for producing recombinant RPRML, though proper folding may be a concern for complex eukaryotic proteins.

  • Baculovirus expression systems: These often provide better post-translational modifications and protein folding for Xenopus proteins.

  • Cell-free translation systems: Xenopus egg extracts themselves can be used as powerful cell-free translation systems for producing recombinant proteins with proper modifications.

  • Mammalian cell expression: HEK293 or CHO cells can be transfected with RPRML constructs for expression of properly folded protein.

For RPRML specifically, creating fusion proteins with purification tags (His, GST, or MBP) can facilitate purification while preserving functional domains. When designing expression constructs, it's important to consider that RPRML is an intronless gene, which simplifies cloning from genomic DNA .

What are the recommended approaches for studying RPRML function in Xenopus embryos?

Several methodological approaches can be employed to study RPRML function in Xenopus embryos:

ApproachMethodologyAdvantagesLimitations
CRISPR-Cas9 knockoutMicroinjection of Cas9 protein and sgRNAs targeting RPRML into fertilized eggsComplete gene disruption; heritable modificationsPotential off-target effects; requires validation
Antisense morpholinosMicroinjection of RPRML-targeting morpholinos into embryosRapid knockdown; dose-dependent effectsTransient effects; potential non-specific toxicity
mRNA overexpressionMicroinjection of in vitro transcribed RPRML mRNAGain-of-function studies; can rescue knockdownsTransient expression; non-physiological levels
Transgenic approachesIntegration of reporter constructs driven by RPRML promoterVisualization of expression patterns; tissue-specific studiesTime-consuming; variable expression levels

When conducting these experiments, it's critical to include appropriate controls and validate phenotypes using multiple approaches. For example, when using CRISPR-Cas9, researchers should confirm gene disruption through sequencing and include rescue experiments with wild-type RPRML mRNA to demonstrate specificity .

What techniques are most effective for detecting endogenous RPRML expression in Xenopus tissues?

For detecting endogenous RPRML expression in Xenopus tissues, researchers can employ multiple complementary techniques:

  • RT-qPCR: For quantitative analysis of RPRML transcript levels across different tissues or developmental stages. When designing primers, consider the intronless nature of RPRML to avoid genomic DNA amplification.

  • In situ hybridization: To visualize spatial expression patterns in embryos or tissue sections. RNA probes should be designed with high specificity for RPRML to avoid cross-reactivity with related family members.

  • Immunohistochemistry/immunofluorescence: Using validated antibodies against Xenopus RPRML or cross-reactive antibodies from other species. Validation of antibody specificity is crucial.

  • Western blotting: For quantitative protein expression analysis in tissue extracts.

  • Mass spectrometry: For unbiased detection and quantification of RPRML protein. Deep proteomics of Xenopus embryos has successfully identified thousands of proteins, making this a viable approach for detecting low-abundance proteins like RPRML .

When selecting a detection method, consider the developmental stage and tissue type. For example, mass spectrometry has been particularly successful in identifying proteins in Xenopus eggs due to the large amount of material available .

What is known about the regulation of RPRML expression during Xenopus development?

While specific information about RPRML regulation in Xenopus development is limited in the provided search results, we can infer potential regulatory mechanisms based on data from other systems:

  • Temporal regulation: In zebrafish, RPRML expression shows specific temporal patterns during embryonic development, particularly during stages crucial for definitive hematopoiesis .

  • Wnt/β-catenin signaling: In colorectal cancer cells, RPRML has been identified as a target of the Wnt/β-catenin signaling pathway . Given the importance of Wnt signaling in Xenopus development, this may represent an important regulatory mechanism in embryonic contexts as well.

  • Epigenetic regulation: DNA methylation has been shown to silence RPRML expression in gastric cancer . Developmental epigenetic programming may similarly regulate RPRML expression during normal embryogenesis.

To comprehensively characterize RPRML regulation in Xenopus, researchers could perform:

  • Promoter analysis to identify transcription factor binding sites

  • ChIP-seq to identify proteins binding to the RPRML promoter during development

  • Reporter assays to delineate regulatory elements controlling stage- and tissue-specific expression

How does RPRML activity relate to apoptotic pathways during embryonic development?

RPRML appears to play a significant role in regulating apoptotic pathways during embryonic development. In zebrafish, loss of RPRML increases caspase-3 activity in endothelial cells within the caudal hematopoietic tissue, suggesting that RPRML normally suppresses inappropriate apoptosis in these cells . This increased apoptosis may contribute to the observed impairment in definitive hematopoiesis.

The relationship between RPRML and apoptosis is further supported by studies of its family member, Reprimo (RPRM). Recent research has shown that Reprimo protein is secreted and can extrinsically induce apoptosis in recipient cells . Reprimo acts upstream of the Hippo–YAP/TAZ–p73 axis and induces apoptosis by transactivating various proapoptotic genes . Given the structural similarities between RPRM and RPRML, it is possible that RPRML may function through similar mechanisms.

In gastric cancer, RPRML downregulation is associated with reduced expression of the apoptotic marker cleaved caspase-3 . This further supports RPRML's role in promoting apoptotic pathways, which may be essential for normal tissue development and homeostasis.

How is RPRML dysregulated in cancer, and what can Xenopus models contribute to this understanding?

RPRML has been implicated as a tumor suppressor in several cancer types. In gastric cancer, RPRML expression is significantly downregulated compared to normal adjacent tissues, and this loss of expression is associated with reduced apoptotic marker cleaved caspase-3 and worse prognosis in patients with advanced stages of the disease . The silencing of RPRML in gastric cancer is mediated by DNA methylation, similar to its homolog RPRM .

Xenopus models can provide unique insights into RPRML's role in cancer through:

  • Developmental context: Using Xenopus to study how RPRML functions in normal development can illuminate how its dysregulation contributes to cancer. The large size and accessibility of Xenopus embryos make them ideal for studying developmental processes that may be co-opted in cancer.

  • Biochemical studies: Xenopus egg extracts provide a powerful biochemical system for studying protein interactions and modifications. These extracts contain approximately 11,000 proteins and can be used to study RPRML's interactions with other proteins and its role in cell cycle regulation .

  • Tumor formation models: Xenopus can be used to study tumor formation by overexpressing oncogenes or suppressing tumor suppressors like RPRML in developing embryos.

  • Drug screening: Xenopus embryos can be used for initial screening of compounds that might restore RPRML function or target pathways affected by RPRML loss.

What are the differences between RPRM and RPRML in their tumor suppressive functions?

Based on the available data, both RPRM and RPRML appear to function as tumor suppressors, but with some distinct mechanisms:

FeatureRPRMRPRML
Cellular locationSecreted proteinCytoplasmic expression reported in gastric epithelial cells
Cell cycle regulationFunctions at G2/M checkpointInhibits cell cycle progression at G2/M phase
Apoptosis mechanismExtrinsically induces apoptosis through FAT/CELSR receptorsAssociated with caspase-3 activity
Signaling pathwayActs upstream of Hippo–YAP/TAZ–p73 axisPotentially involved in Wnt/β-catenin signaling
Cancer typesMultiple cancer typesPrimarily studied in gastric and colorectal cancers

RPRM functions as a secreted protein that extrinsically induces apoptosis in recipient cells through binding to FAT1, FAT4, CELSR1, CELSR2, and CELSR3 receptors . It acts upstream of the Hippo–YAP/TAZ–p73 axis and induces apoptosis by transactivating various proapoptotic genes .

RPRML, while less extensively characterized, has been shown to inhibit cell cycle progression at the G2/M phase, reduce cell proliferation, clonogenic capacity, and anchorage-independent growth when overexpressed in gastric cancer cell lines . Like RPRM, RPRML appears to have a role in apoptosis, as its downregulation is associated with reduced cleaved caspase-3 expression .

Both proteins are silenced by DNA methylation in cancer, suggesting common epigenetic regulatory mechanisms despite their distinct functions .

How can researchers effectively study the methylation status of RPRML in cancer models?

Studying the methylation status of RPRML in cancer models, including those derived from Xenopus systems, can be approached through several methodologies:

  • Bisulfite sequencing: The gold standard for analyzing DNA methylation at single-nucleotide resolution. This technique involves treating DNA with bisulfite, which converts unmethylated cytosines to uracils while leaving methylated cytosines unchanged, followed by PCR and sequencing.

  • Methylation-specific PCR (MSP): A targeted approach using primers designed to amplify either methylated or unmethylated versions of the RPRML promoter region.

  • Pyrosequencing: Provides quantitative methylation data for specific CpG sites within the RPRML promoter.

  • Methylation arrays: For genome-wide methylation analysis that includes the RPRML locus.

  • Cell-free DNA analysis: Circulating methylated RPRML DNA in plasma samples has been explored as a non-invasive biomarker for gastric cancer diagnosis . This approach could be adapted for other cancer types.

For functional studies, researchers can:

  • Use DNA methyltransferase inhibitors (e.g., 5-azacytidine) to reverse RPRML methylation and assess phenotypic changes

  • Create reporter constructs containing the RPRML promoter to study methylation-dependent transcriptional regulation

  • Perform ChIP assays to identify proteins binding to methylated versus unmethylated RPRML promoter regions

In Xenopus cancer models, these approaches could be combined with the injection of oncogenes to induce tumor-like growths, allowing for the study of RPRML methylation during cancer progression.

What technical challenges exist in expressing and purifying functional recombinant RPRML for structural studies?

Expressing and purifying functional recombinant RPRML presents several technical challenges:

  • Protein solubility: As a potential membrane-associated or secreted protein, RPRML may have hydrophobic regions that can reduce solubility during recombinant expression. Optimization of expression conditions (temperature, induction time) and the use of solubility-enhancing fusion tags (MBP, SUMO) may be necessary.

  • Post-translational modifications: If RPRML requires specific post-translational modifications for function, prokaryotic expression systems may be inadequate. Eukaryotic expression systems (insect cells, mammalian cells) or Xenopus egg extracts may better preserve these modifications .

  • Protein stability: Purified RPRML may have limited stability in solution. Buffer optimization (pH, salt concentration, additives) and storage conditions need to be carefully determined.

  • Structural integrity: Ensuring that recombinant RPRML maintains its native conformation is crucial for functional and structural studies. Circular dichroism or limited proteolysis can be used to assess structural integrity.

  • Expression yield: Low expression yields can hinder structural studies. Codon optimization for the expression system and the use of strong promoters may improve yields.

For structural studies specifically, researchers might consider:

  • Expressing specific domains rather than the full-length protein

  • Using cryo-EM for structural determination if crystallization proves challenging

  • Employing hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

How can proteomics approaches be optimized to study RPRML-associated protein complexes?

Optimizing proteomics approaches for studying RPRML-associated protein complexes requires careful consideration of sample preparation, enrichment strategies, and analysis methods:

  • Sample preparation from Xenopus tissues:

    • Utilize the large size of Xenopus eggs/embryos to obtain sufficient starting material

    • Employ gentle lysis conditions to preserve protein-protein interactions

    • Consider crosslinking approaches to stabilize transient interactions

  • Enrichment strategies:

    • Immunoprecipitation using validated anti-RPRML antibodies

    • Tandem affinity purification using tagged RPRML constructs

    • Proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to RPRML in vivo

  • Mass spectrometry analysis:

    • Recent advances in Xenopus proteomics have achieved identification of ~15,000 proteins and ~11,500 phospho-sites

    • Apply similar deep profiling techniques to identify RPRML interactors

    • Consider analyzing samples across developmental timepoints to capture dynamic interactions

    • Employ quantitative approaches (SILAC, TMT) to distinguish specific from non-specific interactions

  • Data analysis:

    • Use appropriate controls (IgG, unrelated protein) for background subtraction

    • Apply stringent statistical filters to identify high-confidence interactors

    • Integrate with existing protein interaction databases

    • Validate key interactions through orthogonal methods (co-IP, yeast two-hybrid)

The large size and biochemical accessibility of Xenopus eggs/embryos make them particularly well-suited for these proteomic approaches, as demonstrated by successful deep proteomic analyses in previous studies .

What approaches can be used to investigate the potential secretory nature of RPRML in Xenopus systems?

Given that Reprimo (RPRM) has been identified as a secreted protein , it is reasonable to investigate whether RPRML might also function as a secreted factor. Several approaches can be employed in Xenopus systems:

  • Secretion assays:

    • Express tagged RPRML in Xenopus oocytes and analyze culture medium for secreted protein

    • Use explant cultures from RPRML-expressing tissues and analyze conditioned medium

    • Employ pulse-chase experiments to track protein trafficking through secretory pathways

  • Structural and sequence analysis:

    • Analyze RPRML sequence for signal peptides using prediction algorithms

    • Compare with known secreted proteins including RPRM

    • Examine glycosylation patterns characteristic of secreted proteins

  • Functional studies:

    • Test whether conditioned medium from RPRML-expressing cells can influence recipient cells

    • Perform transplantation experiments to test for non-cell-autonomous effects

    • Use protein transport inhibitors (Brefeldin A) to block secretion and assess phenotypic consequences

  • Imaging approaches:

    • Use fluorescently tagged RPRML to visualize trafficking in live cells

    • Perform immunohistochemistry with antibodies against RPRML in combination with secretory pathway markers

    • Employ super-resolution microscopy for detailed subcellular localization

If RPRML proves to be secreted, further studies could investigate:

  • The receptor(s) mediating its effects (potentially similar to the FAT/CELSR receptors identified for RPRM )

  • The signaling pathways activated in recipient cells

  • The range of action (autocrine, paracrine, or endocrine)

How might the quasi-tetraploid nature of the Xenopus laevis genome impact RPRML functional studies?

The quasi-tetraploid nature of the Xenopus laevis genome presents both challenges and opportunities for RPRML functional studies:

  • Gene redundancy:

    • Multiple copies of RPRML may exist in the X. laevis genome, similar to other genes that have been found to have multiple copies

    • Functional redundancy may mask phenotypes in single-gene knockout studies

    • Complete functional analysis may require targeting all gene copies

  • Experimental design considerations:

    • CRISPR-Cas9 strategies may need to target conserved regions in all gene copies

    • Morpholino designs should account for potential sequence variations between paralogs

    • Expression studies should distinguish between different gene copies when possible

  • Evolutionary insights:

    • Comparison of RPRML paralogs may reveal subfunctionalization or neofunctionalization events

    • Analysis of conserved versus divergent regions can highlight functionally critical domains

    • Comparison with diploid X. tropicalis can provide evolutionary context

  • Technical advantages:

    • The quasi-tetraploid nature has driven development of sophisticated genomic tools for Xenopus

    • Deep proteomics approaches have successfully identified thousands of proteins despite genomic complexity

    • Population polymorphisms observed in other Xenopus genes may also affect RPRML, providing natural variants for functional studies

To address these challenges, researchers should:

  • Design experiments that account for potential gene duplications

  • Sequence all RPRML copies in their specific X. laevis strain

  • Consider using X. tropicalis (diploid) for complementary studies

  • Employ comprehensive knockout strategies targeting all gene copies

What are the most promising future research directions for understanding RPRML function in development and disease?

Based on current knowledge, several promising research directions emerge for further understanding RPRML function:

  • Mechanistic studies of RPRML in hematopoiesis:

    • Detailed characterization of how RPRML regulates definitive hematopoiesis

    • Investigation of cell-autonomous versus non-cell-autonomous effects

    • Exploration of potential RPRML-mediated interactions between endothelial cells and hematopoietic precursors

  • RPRML signaling pathway elucidation:

    • Identification of upstream regulators and downstream effectors

    • Determination of whether RPRML signals through the Hippo pathway, similar to RPRM

    • Characterization of potential receptor-mediated signaling if RPRML proves to be secreted

  • Translational applications:

    • Development of RPRML-based therapeutic approaches for cancer

    • Exploration of RPRML as a biomarker for cancer diagnosis and prognosis

    • Investigation of RPRML in other diseases beyond cancer, particularly hematological disorders

  • Evolutionary studies:

    • Comparative analysis of RPRML function across vertebrate species

    • Investigation of how RPRML and RPRM diverged functionally during evolution

    • Examination of RPRML in context of the evolution of definitive hematopoiesis

  • Structural biology:

    • Determination of RPRML three-dimensional structure

    • Structure-function analyses to identify critical domains

    • Investigation of potential conformational changes upon activation or binding to partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.