Recombinant Xenopus laevis Reticulon-1-A (rtn1-a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To request a specific tag, please indicate your preference; we will prioritize fulfilling specified tag requests.
Synonyms
rtn1-a; Reticulon-1-A; RTN1.1; xRTN1; XRTN1-C.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rtn1-a
Target Protein Sequence
MQASADSTRMECLWSNWKCQAIDLLYWRDIKQTGIVFGSVLLMLFSLIQFSVVSVMAYLA LAALSATISFRIYKSVLQAVQKTDEGHPFKSYLDMEISLSQEQIQKYTDCLQVYTNSIAK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQ YLGLVRTNMNTIMTKIQAKIPGTKQKE
Uniprot No.

Target Background

Function
Inhibits amyloid precursor protein processing, likely by blocking BACE1 activity.
Gene References Into Functions
  1. XRTN1-C is expressed in the developing brain and spinal cord. PMID: 17969151
Database Links

KEGG: xla:496390

UniGene: Xl.24060

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus.
Tissue Specificity
Expressed in the animal hemisphere (presumptive neural ectoderm) of blastula and gastrula stage embryos, and along the anterior neural border, in the panplacodal primordium, and in the dorsolateral side of archenteron roof of late neurula embryos. At the

Q&A

What is Reticulon-1-A and why is it studied in Xenopus laevis?

Reticulon-1-A belongs to the reticulon (RTN) family of proteins, also known as neuroendocrine-specific protein. These proteins possess a conserved reticulon domain and are associated with the endoplasmic reticulum (ER) membrane. Xenopus laevis serves as an excellent model organism for studying rtn1-a due to its evolutionary closeness to higher vertebrates in terms of physiology, gene expression, and organ development, making it valuable for understanding neural development processes . The specific expression patterns of rtn1-a in neural tissues make it an important marker for studying neurogenesis and differentiation in vertebrate development .

What are the structural characteristics of Xenopus Reticulon-1-A?

Xenopus Reticulon-1-A (XRTN1-A) contains an open reading frame of 752 amino acids with a conserved reticulon domain . Sequence analysis reveals that XRTN1-A has an ER membrane retention signal and four putative membrane-spanning domains that facilitate its association with the ER membrane . This structural organization is essential for its cellular localization and function. The protein's membrane topology is characteristic of the reticulon family, with both N- and C-termini facing the cytoplasm and two hydrophobic segments inserted into the ER membrane .

FeatureXRTN1-AXRTN1-C
Amino acid length752207
Conserved domainsReticulon domainReticulon domain
Membrane featuresER retention signal, 4 membrane-spanning domainsER retention signal, 4 membrane-spanning domains
Expression patternEarly neural precursors, trigeminal placode, olfactory placode, lateral line placode, otic vesicleDeveloping brain and spinal cord
Thyroid hormone regulationDown-regulated in premetamorphic tadpolesNot specified in available data

What expression patterns does rtn1-a show during Xenopus development?

XRTN1-A exhibits specific spatiotemporal expression patterns during Xenopus development. Reverse transcription-polymerase chain reaction and whole-mount in situ hybridization have demonstrated that XRTN1-A is expressed in early neural precursors and differentiating neuronal populations, including the trigeminal placode, olfactory placode, lateral line placode, and otic vesicle . This expression pattern indicates its importance in the early stages of neural development and specification of sensory structures. By contrast, the related XRTN1-C isoform is primarily expressed in the developing brain and spinal cord, suggesting distinct developmental roles for these two variants .

What subcellular fractionation methods are most effective for studying native rtn1-a localization?

For studying rtn1-a's subcellular localization, differential centrifugation combined with density gradient separation has proven effective. Research has shown that XRTN1-C protein is detected in the heavy membrane fraction, which contains lysosomal and ER-resident proteins, as well as in the nucleus and polysomal fractions of the Xenopus embryo . Following tissue homogenization, initial low-speed centrifugation removes nuclei and debris, while subsequent high-speed centrifugation isolates membrane fractions. Further separation through density gradients can isolate specific membrane compartments for analysis. Immunoblotting with anti-rtn1-a antibodies can then determine the protein's distribution across cellular compartments.

What are the technical challenges in working with recombinant rtn1-a due to its membrane association?

The membrane association of rtn1-a presents several technical challenges for recombinant protein work. As a protein with four membrane-spanning domains and ER membrane retention signals , it can be difficult to maintain proper folding and solubility when expressed in bacterial systems. Researchers often need to optimize expression conditions, including temperature, induction time, and host strain selection. Additionally, extraction from bacterial membranes may require careful detergent selection to solubilize the protein without denaturing it. These challenges necessitate careful experimental design and optimization when working with recombinant rtn1-a.

How does thyroid hormone regulation of rtn1-a impact Xenopus development?

Thyroid hormone specifically down-regulates XRTN1-A mRNA in the head of premetamorphic Xenopus tadpoles . This regulation suggests that rtn1-a plays a role in the thyroid hormone-dependent remodeling of the nervous system during metamorphosis. The temporal correlation between thyroid hormone signaling and changes in rtn1-a expression provides insight into the molecular mechanisms underlying amphibian metamorphosis, particularly neural remodeling. This hormone-dependent regulation presents an interesting model for studying the integration of endocrine signals with neural development processes.

How do the functions of XRTN1-A differ from XRTN1-C in Xenopus neural development?

XRTN1-A and XRTN1-C show distinct expression patterns during Xenopus development, suggesting different functional roles . While XRTN1-A is predominantly expressed in early neural precursors and peripheral sensory structures, XRTN1-C is primarily expressed in the developing central nervous system, including the brain and spinal cord . Additionally, XRTN1-C protein has been localized to the ER of Xenopus and mammalian cells and to granules in neurites of primary neurons of the Xenopus spinal cord and rat hippocampus . These differences in expression patterns and subcellular localization suggest that these isoforms may have complementary functions in different aspects of neural development.

How can CRISPR/Cas9 genome editing be applied to study rtn1-a function in Xenopus?

CRISPR/Cas9 genome editing offers a powerful approach for investigating rtn1-a function in Xenopus. The availability of genomic sequences for Xenopus laevis in public databases facilitates the design of specific guide RNAs targeting the rtn1-a gene . Using techniques established for Xenopus, researchers can inject Cas9 protein along with guide RNAs into early embryos to generate targeted mutations. The technique is particularly valuable for creating knockout models to assess loss-of-function phenotypes or for introducing specific mutations to study structure-function relationships. The continuously updated genomic resources and established protocols for Xenopus make this approach increasingly accessible .

What cell-free systems can be developed from Xenopus eggs to study rtn1-a function?

Xenopus laevis eggs provide an excellent source for developing cell-free systems to study protein function, including rtn1-a. A high-speed supernatant prepared from unfertilized eggs can be used to create a cell-free system suitable for recombinant protein studies . Such systems retain much of the cellular machinery necessary for protein folding, modification, and function. For studying membrane proteins like rtn1-a, these extracts can be supplemented with isolated membrane fractions or synthetic lipid vesicles to provide an appropriate environment for the protein. These cell-free systems offer the advantage of controlled experimental conditions while maintaining a near-native biochemical environment.

Research ObjectiveRecommended TechniquesKey Considerations
Expression analysisRT-PCR, whole-mount in situ hybridizationStage-specific sampling, probe specificity
Protein localizationImmunofluorescence, subcellular fractionationAntibody validation, membrane protein extraction
Functional studiesCRISPR/Cas9 gene editing, morpholino knockdownIsoform specificity, off-target effects
Protein-protein interactionsCo-immunoprecipitation, proximity labelingMembrane protein solubilization conditions
Structural analysisComputational modeling, limited proteolysisChallenges with transmembrane domains

How can computational modeling help predict the structure-function relationships of rtn1-a?

Computational modeling provides valuable insights into rtn1-a structure-function relationships, especially given the challenges of experimental structural determination for membrane proteins. Sequence analysis has already identified key features such as the reticulon domain and membrane-spanning regions in XRTN1-A . Advanced homology modeling can predict three-dimensional structures based on related proteins with known structures. Molecular dynamics simulations can model how rtn1-a interacts with the ER membrane and potentially with other proteins. These computational approaches can generate testable hypotheses about which regions of the protein are critical for its function, guiding experimental design and interpretation.

What protein-protein interactions have been identified for rtn1-a and how can these be studied?

While the specific protein interaction network of Xenopus rtn1-a is still being elucidated, its localization to the ER membrane suggests potential interactions with components of the protein synthesis, folding, and trafficking machinery . To identify interaction partners, researchers can employ techniques such as co-immunoprecipitation followed by mass spectrometry analysis. Given the membrane association of rtn1-a, careful consideration of detergent conditions is essential to preserve native interactions. Other approaches include proximity labeling techniques, where enzymes fused to rtn1-a biotinylate nearby proteins, allowing for the identification of the local protein environment.

How can recombinant rtn1-a be used to develop antibodies for immunohistochemistry in Xenopus research?

Recombinant Xenopus laevis Reticulon-1-A provides an excellent antigen source for antibody development. Purified recombinant protein can be used to immunize animals for polyclonal antibody production or to screen monoclonal antibody libraries. For optimal results, researchers should consider using specific fragments of the protein that exclude hydrophobic transmembrane domains, which may be poorly immunogenic or lead to non-specific antibodies. Resulting antibodies should be rigorously validated using Western blotting against both recombinant protein and native Xenopus tissue extracts, followed by immunohistochemistry with appropriate positive and negative controls.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.