Reticulon-1-B belongs to the reticulon (RTN) family of proteins that has attracted significant scientific attention in recent years. These proteins were initially identified as neuroendocrine-specific proteins (NSPs) recognized by lung cancer monoclonal antibodies specific to small-cell lung carcinoma cell lines . The reticulon family is characterized by proteins that possess a conserved reticulon domain and are associated with the endoplasmic reticulum (ER) membrane .
Xenopus laevis, the African clawed frog, serves as an important model organism in developmental biology, making its reticulon proteins particularly valuable for studying evolutionary conservation of function. While research has extensively characterized Xenopus Reticulon-1-A (XRTN1-A) and Reticulon-1-C (XRTN1-C), Reticulon-1-B (rtn1-b) represents another important isoform of the RTN1 gene . These protein variants arise through alternative splicing mechanisms, allowing for diverse functional roles despite sharing core structural elements.
The study of rtn1-b in Xenopus provides valuable insights into both protein function and evolutionary conservation across species. As a member of the reticulon family, rtn1-b likely participates in shaping the tubular endoplasmic reticulum and potentially influences membrane trafficking, synaptic plasticity, and neurodevelopmental processes . Understanding its structure and function contributes significantly to our broader knowledge of cellular organization and neural development.
Xenopus laevis Reticulon-1-B is characterized by a full-length sequence consisting of 752 amino acids, making it substantially larger than its RTN1-C counterpart which contains only 207 amino acids . The complete amino acid sequence of rtn1-b begins with MAANPEDFSGWLEGNVAAARRHRGAEEEEGEAAEQGRTIKAQQAGHQPVAMEMTSTDSTN and continues through to the C-terminal sequence ending with AQIDQYLGLVRTNMNIIVTKIQAKIPGTKQKE . This extensive protein sequence contains several functionally important domains and motifs.
Similar to other reticulon family members, rtn1-b contains a conserved reticulon domain, which is the defining feature of this protein family . Sequence analysis indicates that rtn1-b possesses an ER membrane retention signal, which facilitates its localization to the endoplasmic reticulum . Additionally, the protein contains four putative membrane-spanning domains, which are critical for its integration into the ER membrane and its function in membrane shaping .
The membrane topology of rtn1-b follows the characteristic pattern of reticulon proteins, with both the N-terminus and C-terminus facing the cytoplasmic side of the ER membrane . The four membrane-spanning domains are arranged in a hairpin-like structure within the membrane, which is thought to induce curvature in the ER membrane, contributing to the formation and maintenance of tubular ER .
The sequence VIGMTSILGPKPLTFFKKKAIDLLYWRDVKQTGIVFGSILLMLFSLTLFSVVSVIAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKSYLDIEISLSQEQIQKYTGCFQLYTNSIAKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQ contains the transmembrane regions that anchor the protein within the ER membrane . These hydrophobic segments are critical for the membrane-shaping properties of reticulon proteins.
Recombinant Xenopus laevis Reticulon-1-B protein can be successfully expressed in Escherichia coli expression systems, providing a reliable source for research applications . The recombinant protein (catalog number RFL14829XF) comprises the full-length sequence (1-752 amino acids) fused to an N-terminal histidine tag, which facilitates purification through affinity chromatography techniques . The His-tag also provides a consistent means for protein detection in experimental procedures.
Following expression, the recombinant rtn1-b protein undergoes purification processes that typically yield preparations with purity greater than 90% as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . The high purity ensures reliable results in downstream applications and research studies.
The purified protein is typically provided in a lyophilized powder form, which enhances stability during storage and shipping . This format allows researchers to reconstitute the protein at desired concentrations appropriate for their specific experimental requirements.
Based on studies of related reticulon proteins in Xenopus, rtn1-b is likely localized primarily to the endoplasmic reticulum membrane . The protein's membrane spanning domains and ER retention signal direct it to this cellular compartment, where it functions in membrane shaping and organization . By inference from studies on XRTN1-C, rtn1-b may also be found in granules within neurites of primary neurons and potentially in the nucleus and polysomal fractions .
Reticulon proteins, including rtn1-b, form immobile oligomers within the tubular endoplasmic reticulum, which is essential for their function in maintaining ER tubule structure . This oligomerization creates arc-like scaffolds that help generate and stabilize the high curvature found in ER tubules.
While specific expression patterns for rtn1-b have not been directly reported in the search results, related XRTN1 isoforms show expression in neural tissues during Xenopus development . XRTN1-A is expressed in early neural precursors and differentiating neuronal populations, including the trigeminal placode, olfactory placode, lateral line placode, and otic vesicle . XRTN1-C is expressed in the developing brain and spinal cord .
By analogy, rtn1-b likely follows similar neural-specific expression patterns, potentially with its own unique temporal and spatial distribution during development. This neural-enriched expression aligns with the original identification of reticulons as neuroendocrine-specific proteins and suggests important functions in neural development and physiology.
Thyroid hormone has been shown to specifically down-regulate XRTN1-A mRNA in the head of premetamorphic Xenopus tadpoles . This regulatory relationship highlights the potential for hormonal control of reticulon expression during development. While not directly demonstrated for rtn1-b, similar regulatory mechanisms may apply, given the shared genetic origin of the RTN1 isoforms.
Recombinant Xenopus laevis Reticulon-1-B serves as a valuable tool in developmental biology research, particularly for studying neural development . The protein can be used to investigate the roles of reticulon family members in shaping the neuronal endoplasmic reticulum and potentially in synapse formation and function. Additionally, as Xenopus is an important model organism, studies with rtn1-b contribute to our understanding of conserved developmental mechanisms across vertebrates.
The evolutionary conservation of reticulon proteins makes rtn1-b valuable for comparative studies across different species . By comparing the structure, function, and expression patterns of rtn1-b with reticulon proteins from mammals and other vertebrates, researchers can gain insights into both conserved and divergent aspects of reticulon biology. These comparisons enhance our understanding of the evolutionary significance of these proteins and their fundamental roles in cellular organization.
For optimal results, the vial containing lyophilized protein should be briefly centrifuged prior to opening to ensure all material is at the bottom . The protein should be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .
For long-term storage of reconstituted protein, it is recommended to add glycerol to a final concentration of 5-50% and aliquot before storing at -20°C to -80°C . The default recommended final concentration of glycerol is 50%, which provides optimal cryoprotection while maintaining protein solubility and activity .
KEGG: xla:496397
UniGene: Xl.8555
Xenopus laevis Reticulon-1-B (rtn1-b) is one of the homologues of Reticulon1 in Xenopus laevis, belonging to the reticulon (RTN) family. This protein family is characterized by a conserved C-terminal reticulon-homology domain (RHD). In Xenopus, researchers have identified and characterized RTN1-A (XRTN1-A) and RTN1-C (XRTN1-C) variants, with XRTN1-A containing an open reading frame of 752 amino acids and XRTN1-C containing 207 amino acids .
The reticulon family in mammals consists of four members (RTN1 to RTN4), each with multiple spliced variants resulting from alternative exons or translation initiation codons. While N-terminal sequences among RTN members are completely divergent, the C-terminal RHD is highly conserved across species and family members. This domain contains two transmembrane-anchoring stretches separated by a 66 amino acid-long loop and a short C-terminal tail, which is essential for proper localization to the endoplasmic reticulum (ER) .
When working with Xenopus RTN1-B, researchers should consider several key structural features:
Reticulon Domain: XRTN1-B contains the characteristic conserved reticulon domain that defines the RTN family .
Membrane Topology: Sequence analysis reveals that XRTN1 proteins possess an ER membrane retention signal and four putative membrane-spanning domains, which determine their subcellular localization and function .
Full-length Structure: The recombinant full-length protein consists of 752 amino acids (positions 1-752) when expressed with tags such as the N-terminal His tag commonly used in E. coli expression systems .
Amino Acid Sequence Specificity: The amino acid sequence includes specific regions that contribute to its functional properties and interactions with other cellular components .
Understanding these structural features is essential for designing experiments involving recombinant RTN1-B, as they will influence protein folding, localization, and functional studies in various experimental systems.
The expression pattern of RTN1 variants in Xenopus shows distinct developmental regulation:
XRTN1-A is predominantly expressed in early neural precursors and differentiating neuronal populations. Specific regions of expression include the trigeminal placode, olfactory placode, lateral line placode, and otic vesicle, suggesting its importance in the development of sensory structures .
XRTN1-C expression is more concentrated in the developing brain and spinal cord, indicating a role in central nervous system development .
Developmental regulation is evidenced by the fact that thyroid hormone specifically down-regulates XRTN1-A mRNA in the head of premetamorphic Xenopus tadpoles, suggesting hormonal control of RTN1 expression during metamorphosis . This provides valuable insight into the potential role of RTN1 variants in tissue remodeling and neural development during this critical developmental transition.
Comparative analysis between RTN1 and other family members reveals important distinctions in neural expression:
Neuronal Specificity: RTN1, like RTN3, is predominantly expressed by neurons and not by glial cells under normal conditions, indicating neuron-specific functions .
Subcellular Localization Differences: RTN1 shows a distinctive dendritic localization pattern, making it an excellent marker for dendrites of Purkinje cells. In contrast, RTN3 expression is less evident in dendrites, suggesting differential roles in neuronal compartmentalization .
Pathological Associations: In pathological contexts such as Alzheimer's disease, RTN3, but not RTN1, is abundantly enriched in dystrophic neurites surrounding amyloid plaques. This differential association indicates that RTN3 may have a more prominent role in Alzheimer's pathogenesis than RTN1 .
Compensatory Regulation: Expression of RTN1 and RTN3 appears to be tightly regulated in mouse brains, with RTN1 deficiency causing elevation of RTN3 expression. This compensatory mechanism explains why RTN1 deficiency shows no obvious effects on BACE1 activity (an enzyme involved in amyloid precursor protein processing), as the elevated RTN3 compensates for the loss of RTN1 .
These distinctions are critical for researchers studying the specific roles of different reticulon family members in neuronal development, function, and disease.
Based on the available information, researchers have successfully produced recombinant Xenopus RTN1-B using the following approach:
Expression System: E. coli has been successfully used as an expression system for producing recombinant full-length Xenopus laevis RTN1-B protein .
Tagging Strategy: N-terminal His-tagging has proven effective for purification and detection purposes. The His tag allows for efficient purification using metal affinity chromatography while minimizing interference with protein function .
Protein Length Consideration: Expression of the full-length protein (amino acids 1-752) provides the complete functional domains necessary for most experimental applications .
Final Form: The purified protein can be prepared as a lyophilized powder, which enhances stability during storage .
For researchers planning expression and purification of recombinant RTN1-B, it's advisable to:
Use codon-optimized sequences for E. coli expression
Optimize induction conditions to maximize yield
Include protease inhibitors during purification to prevent degradation
Perform quality control testing including SDS-PAGE and Western blotting to confirm protein integrity
Studies of RTN1 variants have successfully employed several techniques to determine subcellular localization:
Subcellular Fractionation: Research has shown that XRTN1-C protein can be detected in the heavy membrane fraction (containing lysosomal and ER-resident proteins), as well as in the nucleus and polysomal fractions of Xenopus embryos. This technique provides quantitative information about protein distribution across cellular compartments .
Immunofluorescence Microscopy: This approach has revealed that XRTN1-C protein localizes to the ER of both Xenopus and mammalian cells, as well as to granules in neurites of primary neurons from Xenopus spinal cord and rat hippocampus .
Co-localization Studies: Combining immunofluorescence with markers for specific subcellular compartments (such as ER, Golgi, or dendritic markers) can provide detailed information about the precise localization of RTN1 proteins. This has been particularly useful in demonstrating that RTN1 serves as an excellent marker for dendrites of Purkinje cells .
Whole-mount In Situ Hybridization: This technique has been valuable for determining the expression patterns of XRTN1-A and XRTN1-C in intact Xenopus embryos, revealing specific expression in neural precursors and differentiating neuronal populations .
These methodologies can be complementary, with fractionation providing quantitative biochemical data and microscopy offering spatial resolution of protein localization within cellular structures.
RTN1-B, like other reticulon family members, exhibits specific interactions with the endoplasmic reticulum (ER) membrane that influence its function:
Membrane Topology: Sequence analysis of XRTN1 proteins reveals an ER membrane retention signal and four putative membrane-spanning domains, which anchor the protein to the ER membrane . This membrane association is critical for its function in regulating ER morphology.
ER Morphogenesis: Reticulon family proteins, including RTN1, play important roles in ER structure and organization. Research on reticulons has shown their involvement in ER morphogenesis, though cells lacking reticulon expression do not exhibit major defects in ER structure, suggesting functional redundancy among family members .
Vesicular Trafficking: RTN1 variants interact with proteins involved in vesicular formation and fusion. Specifically, RTN1C has been found to associate with calreticulin-negative regions of the ER and co-immunoprecipitates with SNARE proteins syntaxin 1, syntaxin 7, syntaxin 13, and VAMP2, suggesting a role in exocytosis . Moreover, RTN1A and RTN1B were found to interact with a component of the mammalian endocytosis adaptor complex AP-2, indicating a potential role in endocytosis .
These interactions have functional implications for membrane trafficking pathways, protein secretion, and potentially for specialized neuronal functions given the enrichment of RTN1 in neuronal tissues and dendrites.
Reticulon proteins, including RTN1, have been implicated in apoptotic regulation through several mechanisms:
Interaction with Anti-apoptotic Proteins: RTN1C has been identified as an interactor with Bcl-XL, a powerful inhibitor of apoptosis. Research indicates that RTN1C can inhibit Bcl-XL, demonstrating a pro-apoptotic role for this reticulon variant .
ER Stress Modulation: RTN1C has been shown to modulate apoptosis by upregulating the sensitivity of the ER to stressors in neuroblastoma cells, potentially linking ER function to cell death pathways .
Comparative Effects: Similar to RTN1C, other reticulon family members also show pro-apoptotic activity. For instance, RTN4A inhibits both Bcl-XL and another apoptosis inhibitor, Bcl-2. Additionally, several laboratories have demonstrated that RTN3 enhances apoptosis via interaction with Bcl-2 .
Tumor Suppression Potential: The pro-apoptotic roles of reticulons suggest they may function in tumor suppression, though this topic remains controversial in the field .
These interactions highlight the multifunctional nature of reticulons beyond their structural roles in the ER membrane, potentially linking membrane organization to cell survival decisions in normal development and disease states.
Recombinant RTN1-B provides several powerful approaches for studying neural development in Xenopus:
Protein Localization Studies: Using tagged recombinant RTN1-B, researchers can track the dynamic localization of this protein during neural development in live or fixed tissues. Since XRTN1-A is expressed in early neural precursors and differentiating neuronal populations (including the trigeminal placode, olfactory placode, lateral line placode, and otic vesicle), while XRTN1-C is expressed in the developing brain and spinal cord, recombinant proteins can serve as markers for these developmental processes .
Protein-Protein Interaction Analysis: Recombinant RTN1-B can be used in pull-down assays or co-immunoprecipitation experiments to identify novel binding partners in developing neural tissues, providing insight into molecular pathways regulating neurogenesis.
Functional Perturbation: Introduction of recombinant protein can potentially act in a dominant-negative manner to disrupt endogenous RTN1-B function, allowing researchers to assess its role in specific developmental processes.
Thyroid Hormone Response Studies: Given that thyroid hormone specifically down-regulates XRTN1-A mRNA in the head of premetamorphic Xenopus tadpoles, recombinant RTN1-B can be used to study hormone-dependent regulation mechanisms in neural development during metamorphosis .
Dendritic Development Analysis: Since RTN1 is enriched in dendrites and serves as an excellent marker for dendrites of Purkinje cells, recombinant RTN1-B could be particularly valuable for studying dendritic development and remodeling in the Xenopus nervous system .
Xenopus offers several distinct advantages for RTN1 research compared to mammalian systems:
Developmental Accessibility: Xenopus provides large, abundant eggs and readily manipulable embryos that develop externally, allowing for easy visualization and manipulation of developmental processes involving RTN1 .
Metamorphosis Model: The process of metamorphosis in Xenopus, which involves dramatic remodeling of tissues including the nervous system, provides a unique opportunity to study RTN1 function during dramatic developmental transitions. This is particularly relevant given the finding that thyroid hormone regulates XRTN1-A expression during metamorphosis .
Complementary Species Advantage: The availability of both Xenopus laevis and Xenopus tropicalis allows researchers to leverage the advantages of both species - the larger size and historical experimental background of X. laevis with the genetic tractability of X. tropicalis .
Expression Systems: Xenopus oocytes have been extensively used as expression chambers to identify novel channels and transporters, providing a system where RTN1 function can be studied in a cellular context different from mammalian cells .
Genetic and Genomic Tools: Recent advances in Xenopus research include:
These advantages position Xenopus as a valuable complementary system to mammalian models for comprehensive understanding of RTN1 function across vertebrate evolution.
Experimental studies have revealed detailed patterns of RTN1 expression during Xenopus neural development:
| Developmental Stage | XRTN1-A Expression | XRTN1-C Expression | Method of Detection |
|---|---|---|---|
| Early neural development | Early neural precursors | Developing brain | RT-PCR and whole-mount in situ hybridization |
| Neuronal differentiation | Trigeminal placode, olfactory placode, lateral line placode, and otic vesicle | Spinal cord | Whole-mount in situ hybridization |
| Premetamorphic tadpole | Down-regulated in head by thyroid hormone | Maintained in CNS | Hormone treatment studies |
These expression patterns indicate that RTN1 variants play distinct roles in neural development, with XRTN1-A potentially involved in sensory system development and XRTN1-C more associated with central nervous system formation .
At the subcellular level, XRTN1-C protein has been detected in multiple cellular compartments, suggesting diverse functions:
| Subcellular Localization | Detection Method | Functional Implication |
|---|---|---|
| Endoplasmic reticulum (ER) | Subcellular fractionation and immunofluorescence | Role in ER morphology and function |
| Neurite granules | Immunofluorescence in primary neurons | Potential role in neuronal transport or local protein synthesis |
| Heavy membrane fraction | Subcellular fractionation | Association with lysosomal and ER-resident proteins |
| Nuclear fraction | Subcellular fractionation | Possible role in nuclear processes |
| Polysomal fraction | Subcellular fractionation | Potential involvement in protein synthesis |
These findings collectively suggest that RTN1 has multifaceted roles in neural development beyond its structural function in the ER membrane .