Recombinant Xenopus laevis Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag based on your request.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rho
Target Protein Sequence
MNGTEGPNFYVPMSNKTGVVRSPFDYPQYYLAEPWQYSALAAYMFLLILLGLPINFMTLF VTIQHKKLRTPLNYILLNLVFANHFMVLCGFTVTMYTSMHGYFIFGPTGCYIEGFFATLG GEVALWSLVVLAVERYIVVCKPMANFRFGENHAIMGVAFTWIMALSCAAPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFIVHFTIPLIVIFFCYGRLLCTVKEAAAQQQES LTTQKAEKEVTRMVVIMVVFFLICWVPYAYVAFYIFTHQGSNFGPVFMTVPAFFAKSSAI YNPVIYIVLNKQFRNCLITTLCCGKNPFGDEDGSSAATSKTEASSVSSSQVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision under low light conditions. It plays a crucial role in maintaining photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Database Links

KEGG: xla:108714644

UniGene: Xl.326

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What advantages does Xenopus laevis rhodopsin offer as a research model compared to mammalian rhodopsins?

Xenopus laevis rhodopsin provides several distinct research advantages over mammalian models. The C-terminal sequence of rhodopsin is highly conserved in mammals but divergent in Xenopus laevis, allowing for comparative studies of signaling domains . This divergence enables researchers to investigate the functional significance of C-terminal modifications through chimeric constructs. Additionally, the Xenopus system facilitates in vivo study of rhodopsin biosynthesis, targeting, and involvement in the phototransduction cascade through transgenic approaches that are relatively straightforward compared to mammalian systems . Notably, the large size of Xenopus photoreceptors and the ability to visualize rhodopsin trafficking in developing tadpoles provide unique experimental capabilities for studying protein localization and cellular dynamics that complement studies in mammalian systems.

What are the optimal expression systems for producing functional recombinant Xenopus laevis rhodopsin?

The choice of expression system for recombinant Xenopus laevis rhodopsin depends on the specific research questions being addressed. For biochemical and structural studies, COS-1 cells have been successfully employed to express functional rhodopsin fusion proteins that correctly bind 11-cis retinal and generate pigments with the spectral properties of both rhodopsin (absorption maximum at 500 nm) and GFP (absorption maximum at 488 nm) . This heterologous mammalian expression system produces sufficient quantities for spectroscopic and functional characterization.

For physiological studies aimed at understanding in vivo dynamics, transgenic Xenopus laevis expressing rhodopsin under the control of the Xenopus laevis rhodopsin promoter (XOP) represents the gold standard approach . Typically, a 1.3 kb fragment of the Xenopus rhodopsin promoter is sufficient to drive rod photoreceptor-specific expression . The REMI-sperm nuclear transplantation method has proven highly effective for generating these transgenic animals . When implementing transgenic approaches, researchers should carefully design constructs that maintain physiological expression levels, as even relatively low expression of mutant rhodopsin (less than 10% of endogenous levels) can produce significant photoreceptor phenotypes .

What are the critical considerations when designing rhodopsin-fluorescent protein fusion constructs?

Designing functionally optimal rhodopsin-fluorescent protein fusion constructs requires careful consideration of several factors:

  • Fusion position: The positioning of the fluorescent protein domain critically impacts rhodopsin function. Placement at the C-terminus of rhodopsin results in wild-type activity for both transducin activation and rhodopsin kinase interactions, while other configurations may significantly impair function . This indicates that the C-terminus tolerates modification without disrupting key protein-protein interactions essential for phototransduction.

  • Linker design: Although not explicitly detailed in the available studies, linker composition and length between rhodopsin and the fluorescent protein domain likely impact both protein folding and function. Optimization may be necessary for specific applications.

  • Fluorescent protein selection: While initial studies utilized GFP, EGFP provides enhanced fluorescence properties that improve visualization without compromising rhodopsin function .

  • Promoter selection: Using the native Xenopus laevis rhodopsin promoter (approximately 1.3 kb fragment) ensures rod photoreceptor-specific expression that mimics endogenous expression patterns .

  • Expression level control: Transgene expression levels must be carefully controlled, as even relatively low levels of mutant rhodopsin expression (less than 10% of endogenous levels) can cause significant photoreceptor degeneration in P23H models .

These design considerations are essential for creating fusion constructs that accurately reflect native rhodopsin biology while providing experimental utility through fluorescent labeling.

How effective is the Xenopus P23H rhodopsin model for studying retinitis pigmentosa mechanisms?

The Xenopus P23H rhodopsin model has proven highly effective for studying mechanisms of autosomal dominant retinitis pigmentosa (ADRP). Transgenic Xenopus laevis expressing P23H mutant rhodopsin exhibit key pathological features seen in both human patients and mammalian models, including:

  • Progressive rod degeneration: Tadpoles expressing P23H rhodopsin develop shortened outer segments and eventually lose rod photoreceptors while cone photoreceptors are preserved . This rod-selective degeneration pattern mirrors the human disease.

  • Regional vulnerability: The ventral retina shows greater susceptibility to degeneration, paralleling patterns observed in other animal models and humans with this mutation . This regional specificity allows investigation of protective mechanisms that may exist in less affected retinal regions.

  • Light modification: Degeneration severity is modified by light exposure , consistent with observations in other systems that suggest light exposure accelerates disease progression through increased activation of mutant rhodopsin.

  • Dominant negative effects: Even low expression levels of mutant rhodopsin (less than 10% of endogenous levels) produce severe rod photoreceptor degeneration , demonstrating the potent dominant negative effect of this mutation.

The Xenopus model offers distinct advantages for mechanistic studies, including the ability to rapidly generate and screen multiple transgenic animals, visualize disease progression in transparent tadpoles, and manipulate environmental factors such as light exposure. These characteristics make it particularly valuable for testing therapeutic interventions aimed at slowing photoreceptor degeneration.

What methodological approaches can distinguish between misfolding and mistrafficking mechanisms in rhodopsin mutants?

Distinguishing between rhodopsin misfolding and mistrafficking mechanisms requires a multifaceted experimental approach. The following methodologies have proven effective in Xenopus models:

  • Subcellular localization analysis: Rhodopsin-fluorescent protein fusions enable direct visualization of protein localization in live photoreceptors. In properly functioning systems, rhodopsin localizes specifically to rod outer segments . Deviation from this pattern may indicate trafficking defects.

  • Biochemical fractionation: Separation of membrane fractions followed by immunoblotting can quantify rhodopsin distribution across subcellular compartments (ER, Golgi, plasma membrane, outer segments).

  • Glycosylation profiling: Rhodopsin undergoes specific glycosylation modifications during trafficking. Analysis of glycosylation patterns (using endoglycosidases and Western blotting) can identify where in the secretory pathway mutant proteins become arrested.

  • Temperature-sensitivity assays: Many misfolding mutants display temperature-dependent phenotypes. Maintaining transgenic animals at different temperatures can distinguish between temperature-sensitive (typically misfolding) and temperature-insensitive (potentially trafficking) defects.

  • Chemical chaperone response: Application of chemical chaperones (such as 4-phenylbutyric acid) that specifically assist protein folding can help determine if the primary defect involves misfolding.

  • Co-expression with trafficking proteins: Co-expression of proteins involved in rhodopsin trafficking can reveal whether increasing transport capacity can overcome defects, suggesting primary trafficking rather than folding issues.

This methodological toolkit allows researchers to systematically characterize rhodopsin mutant defects and develop targeted interventions based on the precise molecular mechanism.

How can spectroscopic analyses be optimized to detect functional differences between wild-type and mutant Xenopus rhodopsin?

Optimizing spectroscopic analyses for detecting functional differences between wild-type and mutant Xenopus rhodopsin requires careful attention to several technical parameters:

These advanced spectroscopic approaches, when properly optimized, can reveal subtle functional differences between wild-type and mutant rhodopsins that may not be apparent with standard biochemical assays.

What are the effective strategies for quantifying rhodopsin transgene expression relative to endogenous rhodopsin?

Accurate quantification of transgenic rhodopsin expression relative to endogenous rhodopsin is critical for interpreting phenotypic effects. The following strategies have proven effective in Xenopus models:

  • RT-PCR with selective primers: Research has demonstrated that RT-PCR using primers that selectively amplify transgenic versus endogenous rhodopsin mRNA can quantify relative expression levels . Studies have shown that less than 10% of mutant transgenic rhodopsin relative to wild-type endogenous rhodopsin mRNA is sufficient to produce severe rod photoreceptor degeneration in P23H models .

  • Introduction of silent mutations: Creating transgenes with silent mutations that create or remove restriction sites (such as the HincII site modification described in research) enables differential analysis of transgenic and endogenous rhodopsin .

  • Western blot analysis: For epitope-tagged constructs, antibodies against the tag can specifically detect transgenic protein, while pan-rhodopsin antibodies detect total (endogenous plus transgenic) expression. The ratio provides relative expression levels.

  • Immunohistochemical quantification: Dual-label immunohistochemistry using tag-specific and rhodopsin-specific antibodies, followed by quantitative image analysis, can determine the ratio of transgenic to endogenous protein at the cellular level.

  • Mass spectrometry: For untagged constructs, subtle amino acid differences between transgenic and endogenous rhodopsin can be detected by mass spectrometry following protein purification, enabling precise quantification of relative abundance.

These quantification approaches are essential for establishing dose-response relationships between mutant rhodopsin expression and photoreceptor phenotypes.

How does the Xenopus laevis rhodopsin C-terminus differ from mammalian rhodopsins, and what are the functional implications?

The C-terminal sequence of rhodopsin exhibits significant divergence between Xenopus laevis and mammals, with important functional implications:

SpeciesC-terminal CharacteristicsFunctional Significance
MammalsHighly conserved sequenceCritical for phosphorylation and arrestin binding
Xenopus laevisDivergent sequenceMay reflect adaptation to aquatic visual environment

This divergence is significant because the C-terminus contains phosphorylation sites critical for signal termination following light activation. Research has shown that chimeric versions of rhodopsin based primarily on Xenopus laevis sequences but with a mammalian C-terminus can cause rod photoreceptor degeneration , suggesting functional incompatibility between the domains.

The divergent C-terminus in Xenopus laevis rhodopsin may reflect evolutionary adaptation to different visual environments and signaling requirements. Despite this sequence divergence, the P23H mutation in the N-terminal region causes similar photoreceptor degeneration in both Xenopus and mammalian systems , indicating that the fundamental mechanisms of protein folding and quality control are conserved across species. This combination of conserved and divergent features makes Xenopus rhodopsin particularly valuable for comparative studies of structure-function relationships.

What can rhodopsin studies in Xenopus reveal about the evolution of vertebrate visual systems?

Rhodopsin studies in Xenopus provide unique evolutionary insights that complement mammalian research:

  • Sequence conservation patterns: The N-terminal and transmembrane domains of rhodopsin show high conservation across vertebrates, while the C-terminus exhibits greater divergence . This pattern suggests differential selective pressure across the protein structure, with critical functional domains maintaining evolutionary stability.

  • Spectral tuning mechanisms: Xenopus rhodopsin maintains the ~500 nm absorption maximum characteristic of terrestrial vertebrates despite the aquatic environment. Comparative studies between Xenopus and fish rhodopsins can reveal the molecular basis for spectral tuning.

  • Signal termination adaptations: The divergent C-terminus in Xenopus rhodopsin may reflect adaptation to different visual environments and phosphorylation requirements. Studies comparing the kinetics of signal termination between Xenopus and mammalian rhodopsin can illuminate evolutionary adaptations to different visual ecologies.

  • Conservation of disease mechanisms: The observation that the P23H mutation causes similar photoreceptor degeneration patterns in both Xenopus and mammals despite sequence divergence indicates that fundamental quality control mechanisms for membrane proteins are evolutionarily ancient and conserved .

  • Promoter evolution: The compact but effective Xenopus rhodopsin promoter (1.3 kb fragment) drives specific expression in rod photoreceptors , suggesting conservation of key transcriptional regulatory mechanisms across vertebrates.

These comparative studies contribute to our understanding of both visual system evolution and fundamental mechanisms of protein quality control that extend beyond the visual system.

How can Xenopus rhodopsin be utilized in optogenetic applications?

Xenopus rhodopsin presents several advantages for optogenetic applications based on its unique properties and experimental tractability:

  • Fusion protein optimization: The successful development of rhodopsin-EGFP fusion proteins with wild-type functionality provides a foundation for creating optogenetic tools with fluorescent readouts. These optimized fusions enable simultaneous activation and visualization of rhodopsin-mediated signaling.

  • Spectral engineering potential: The compatibility of Xenopus rhodopsin with different positions for fluorescent protein fusion suggests flexibility for developing spectrally diverse optogenetic tools. The C-terminal tolerance for modification could potentially accommodate other functional domains besides fluorescent proteins.

  • Heterologous expression capability: Xenopus rhodopsin can be functionally expressed in mammalian cell lines , enabling the development and testing of optogenetic tools in diverse experimental systems before in vivo application.

  • Signaling pathway modulation: The demonstrated ability to measure both transducin activation and rhodopsin kinase interactions suggests potential for developing optogenetic tools that selectively activate or inhibit specific G-protein signaling pathways.

  • Cross-species applications: Heterodimeric photoreceptor systems have been successfully tested in Xenopus laevis oocytes for electrophysiological characterization , suggesting that Xenopus expression systems can be valuable platforms for developing and characterizing novel optogenetic tools derived from diverse organisms.

These characteristics position Xenopus rhodopsin as a valuable component in the expanding optogenetic toolkit, particularly for applications requiring precise control of G-protein signaling pathways with simultaneous visualization.

What are the latest methodological advances in studying rhodopsin-transducin interactions using Xenopus models?

Recent methodological advances for studying rhodopsin-transducin interactions in Xenopus models include:

  • Improved fusion proteins: The development of rhodopsin-EGFP fusion proteins with wild-type activity for transducin activation represents a significant advancement . These constructs enable direct visualization of the activating protein while maintaining normal signaling capabilities.

  • Quantitative activation assays: Techniques for measuring rhodopsin-mediated transducin activation have been refined to detect subtle functional differences between wild-type and mutant or fusion proteins . These assays can quantify both the amplitude and kinetics of activation.

  • Expression system optimization: Both heterologous cell systems (COS-1 cells) and transgenic Xenopus approaches have been optimized for studying rhodopsin-transducin interactions . The choice of system depends on whether biochemical precision or physiological relevance is prioritized.

  • Spectral characterization: Combined spectroscopic analysis of rhodopsin's 500 nm absorption and GFP's 488 nm absorption in fusion proteins enables correlation between structural features and functional outcomes in transducin activation studies .

  • Cross-species compatibility testing: The successful expression and functional characterization of heterodimeric photoreceptor systems in Xenopus laevis oocytes demonstrates the potential for using Xenopus as a platform to study diverse rhodopsin-G protein interaction mechanisms from various species.

These methodological advances collectively enhance our ability to dissect the molecular mechanisms of rhodopsin-transducin interactions with unprecedented precision and physiological relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.