The full-length protein (1–101 amino acids) includes an N-terminal His-tag for affinity purification. The primary sequence is:
MVSLLCCGPKLAACGIVISVWGVIMLILLGVFFNVHSAVLIEDVPFTEEDIFEDPNPPAK MYRLYEQVSYNCFIAAAIYIVLGGFSFCQVRLNKRKEYMVR .
| Feature | Description |
|---|---|
| Source Organism | Xenopus laevis (African clawed frog) |
| Expression Host | E. coli |
| Tag | N-terminal His-tag |
| Protein Length | 101 amino acids (full-length) |
| Purity | >90% (SDS-PAGE confirmed) |
The recombinant protein is produced via bacterial expression in E. coli, followed by His-tag affinity chromatography. Key biochemical properties include:
RNASEK-a exhibits endoribonuclease activity, preferentially cleaving ApU and ApG phosphodiester bonds . The enzyme’s catalytic activity is dependent on an intramolecular disulfide bond between cysteine residues (e.g., Cys6 and Cys69 in human RNASEK) .
Studies in grass carp CIK cells demonstrate that RNASEK-a overexpression:
Upregulates Type I IFN:
Promotes Apoptosis:
| Experimental Model | Effect of RNASEK-a Overexpression | Reference |
|---|---|---|
| CIK Cells | 1.93× increase in TUNEL-positive apoptotic cells | |
| CL Cells | 1.29–1.43× elevation in Bax/Bcl-2 ratio |
RNASEK-a activates eIF2α phosphorylation, a marker of cellular stress and apoptosis . This mechanism is critical in regulating cell survival under viral or pathogenic stress.
In grass carp, RNASEK-a localizes to endosomes and the endoplasmic reticulum, suggesting roles in RNA processing and immune signaling . While Xenopus rnasek-a’s precise pathways are uncharacterized, homology to human RNASEK implicates involvement in:
KEGG: xla:100037220
UniGene: Xl.75276
Recombinant Xenopus laevis rnasek-a is typically produced using E. coli expression systems. The process involves:
Cloning the full-length coding sequence (1-101aa) into an appropriate expression vector
Adding an N-terminal His-tag for purification purposes
Transforming the construct into E. coli
Inducing protein expression under optimized conditions
Purifying using affinity chromatography
Lyophilizing the protein for storage
The purified protein typically has greater than 90% purity as determined by SDS-PAGE and is stored as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .
For optimal stability and activity of recombinant rnasek-a:
Store lyophilized protein at -20°C/-80°C upon receipt
Aliquot to avoid repeated freeze-thaw cycles
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Add 5-50% glycerol (final concentration) for long-term storage
Store working aliquots at 4°C for up to one week
Avoid repeated freezing and thawing
These conditions maintain protein stability and activity for research applications .
When designing an RNA-seq experiment to study rnasek-a expression during Xenopus development:
Sample Selection: Include multiple developmental stages (e.g., NF48, NF54, NF59, and NF66) to capture expression changes during metamorphosis
Replication: Use at least 3 biological replicates per condition to ensure statistical power
Sequencing Parameters:
Depth: 20-30 million reads per sample for differential expression analysis
Read length: ≥75bp paired-end reads for better transcript reconstruction
Library preparation: Use methods that capture full-length transcripts
Controls: Include appropriate stage-matched controls and consider tissue-specific analysis
Analysis Pipeline: Plan for quality control, read alignment to Xenopus laevis v10.1 genome, quantification, and differential expression analysis
This approach will provide robust data on rnasek-a expression patterns across development .
When studying RNA-binding proteins such as rnasek-a, consider these critical experimental design factors:
Sources of Variability:
Biological variability between animals
Technical variability from library preparation (largest source)
Batch effects during sequencing
Read depth variations affecting detection of lowly expressed genes
Core Design Principles:
Replication: Use sufficient biological replicates (minimum 3)
Randomization: Randomize samples during preparation and sequencing
Blocking: Process samples in balanced batches to control for technical variation
Specific Considerations for RNA-binding Proteins:
Include enrichment methods (e.g., CLIP-seq) to identify direct RNA targets
Consider alternative splicing analysis pipelines
Compare expression with known targets to validate function
Preliminary Questions to Address:
Why do you expect differential expression in your tissue of interest?
What types of genes might be regulated by rnasek-a?
What are potential sources of variability in your experimental system?
Following these guidelines will maximize data quality and interpretability .
To investigate subcellular localization and interactions of rnasek-a, consider these methodological approaches:
Fluorescent Protein Fusion Constructs:
Create pEGFP-RNASEK-a constructs for live-cell imaging
Transfect into appropriate cell lines and observe localization patterns
Co-transfect with organelle markers like mitochondria, lysosome, or ER trackers
Co-localization Studies:
Use p3×FLAG-RNASEK-a with fluorescently tagged potential interactors
Perform immunofluorescence with anti-FLAG antibodies
Analyze colocalization with endosomal markers (e.g., pDsRed2-Rab5/7)
Interaction Partner Identification:
Immunoprecipitation followed by mass spectrometry
Yeast two-hybrid screening
Proximity labeling approaches (BioID, APEX)
Functional Genomics:
RNA interference using shRNA (e.g., shRNASEK designs)
CRISPR-Cas9 for gene knockout studies
Rescue experiments with mutant constructs
These approaches can be combined to build a comprehensive picture of rnasek-a's cellular function and interaction network .
RNA-binding proteins, including ribonucleases like rnasek-a, play critical roles in Xenopus development:
Neural Development: RNA-binding proteins are enriched in expression cloning screens from the neural plate, suggesting essential functions in nervous system development
RNA Splicing Regulation: They participate in selective RNA splicing and metabolism, which appears particularly important in early central nervous system development
Developmental Transitions: RNA-binding proteins often regulate transcript stability during metamorphosis and other developmental transitions
Tissue-Specific Expression: Many RNA-binding proteins show tissue-specific expression patterns, with heterogeneous nuclear ribonucleoproteins (hnRNPs) and Serine/Arginine-rich proteins (SR-proteins) being particularly prevalent
Multiple Functions: They contribute to exon definition, alternative splicing, nuclear export of RNA, and mRNA stability
The prevalence of RNA-binding proteins in developmental screens suggests that post-transcriptional regulation is a major mechanism controlling gene expression during embryogenesis .
RNA splicing in Xenopus is regulated through complex mechanisms with potential involvement of rnasek-a:
Essential Splicing Machinery: U1-RNP complexes are critical for intron removal in Xenopus. Antisera against ribonucleoproteins containing U1 small nuclear RNA (Sm and RNP) inhibit splicing of ribosomal protein RNAs when injected into Xenopus oocytes
Developmental Regulation: Splicing patterns change throughout development, particularly during metamorphosis when extensive tissue remodeling occurs
Tissue-Specific Factors: RNA-binding proteins, potentially including rnasek-a, may contribute to tissue-specific splicing patterns
Paralogs and Functional Diversity: The existence of paralog proteins (e.g., RNASEK-a and RNASEK-b) suggests specialized functions in different contexts or tissues
Potential rnasek-a Function: Based on its classification as a ribonuclease, rnasek-a may participate in RNA processing pathways that affect splicing efficiency or specificity, though direct evidence in Xenopus is limited
Understanding the role of rnasek-a specifically will require further functional studies using techniques like antisense oligonucleotides or CRISPR-mediated knockout .
Single-cell RNA-seq offers powerful approaches to study rnasek-a expression across different cell types:
Xenopus Cell Landscape Resource: The recently developed Xenopus Cell Landscape (XCL) provides a valuable reference comprising more than 500,000 cells isolated from four developmental stages and 17 adult tissues, profiling over 100 major cell types
Methodological Approach:
Tissue dissociation using appropriate protocols for your tissue of interest
Single-cell isolation using Microwell-seq or other single-cell platforms
Library preparation and sequencing (10X Genomics platform is commonly used)
Computational analysis including quality control, dimensionality reduction, clustering, and cell type annotation
Analysis Strategy for rnasek-a:
Map expression across identified cell clusters
Perform trajectory analysis to track expression changes during development
Correlate expression with known markers of cell types and states
Identify co-expressed genes for pathway analysis
Comparative Analysis:
Compare rnasek-a expression patterns with other vertebrate models
Analyze expression of both paralogs (rnasek-a and rnasek-b) to identify differential regulation
Integrate with bulk RNA-seq data for validation
This approach can reveal cell type-specific functions and regulatory networks involving rnasek-a .
RNASEK-a and RNASEK-b are paralog proteins that show both structural similarities and functional differences:
Genomic Organization:
Both genes can be amplified from genomic DNA and total RNA
The genomic structure shows some differences reflecting their divergence after duplication
Sequence Comparison:
Both proteins maintain the core ribonuclease domain
Specific sequence variations likely account for functional differences
Comparative analysis of CDS regions can reveal selection pressures on each paralog
Subcellular Localization:
Studies using pEGFP-RNASEK-a and pEGFP-RNASEK-b constructs reveal distinct but overlapping localization patterns
Co-localization experiments with p3×FLAG-RNASEK-a and pEGFP-RNASEK-b show interaction potential
Functional Divergence:
In fish, both paralogs enhance Type I interferon responses
Knockdown experiments using shRNASEK constructs demonstrate specialized functions
Different expression patterns during development suggest tissue-specific roles
This paralog divergence represents an example of subfunctionalization and/or neofunctionalization following gene duplication, contributing to the complexity of RNA processing mechanisms .
Studying ribonucleases like rnasek-a across vertebrates provides valuable evolutionary insights:
Cross-Species Conservation:
The Xenopus Cell Landscape (XCL) resource enables comparison with Human Cell Landscape (HCL), Mouse Cell Atlas (MCA), and Zebrafish Cell Landscape (ZCL)
Endothelial and stromal cells show strongest cross-species correlation in gene expression patterns
Germline of Xenopus shows strongest correlation with zebrafish, weaker with mouse, and minimal with human
Adaptation to Environmental Transitions:
Xenopus undergoes transition from aquatic to terrestrial environments during metamorphosis
RNA processing proteins may play crucial roles in the extensive transcriptional changes during this transition
Comparing lung cell types reveals differences in respiratory adaptations (e.g., Xenopus lacks clear AT1 cells but has enriched pulmonary ionocytes)
Genome Evolution in Xenopus:
Xenopus laevis has a pseudotetraploid genome, often with two copies of genes (e.g., "L" and "S" homeologs)
Some ribosomal protein genes show population polymorphism
Recombinant protein studies reveal gene copy variations (2 copies for r-proteins L1, L14, S19 and 4-5 copies for S1, S8, L32)
These comparative analyses reveal how RNA processing mechanisms have evolved to support species-specific developmental programs while maintaining core functionalities .
Advanced techniques to study rnasek-a's role in RNA metabolism include:
RNA Immunoprecipitation (RIP) and Sequencing:
Use antibodies against rnasek-a to pull down bound RNAs
Sequence recovered RNAs to identify direct targets
Analyze binding motifs and structural preferences
CRISPR/Cas9 Gene Editing:
Create knockout or knockin models in Xenopus
Design gRNAs targeting conserved domains
Analyze resulting phenotypes focusing on RNA processing defects
Ribosome Profiling:
Measure translation efficiency of transcripts in presence vs. absence of rnasek-a
Identify mRNAs whose translation is specifically affected
In Vivo Splicing Assays:
Inject antisera or morpholinos targeting rnasek-a into Xenopus oocytes
Analyze splicing patterns of reporter constructs or endogenous transcripts
Compare with known splicing inhibitors (e.g., anti-U1 snRNP antibodies)
Biochemical Assays:
Express and purify recombinant rnasek-a
Test RNA processing activity on synthetic substrates
Perform structure-function analyses with mutated proteins
These complementary approaches can provide comprehensive insights into rnasek-a's molecular function in RNA metabolism and developmental regulation .
Researchers frequently encounter these challenges when working with recombinant rnasek-a:
Expression and Solubility Issues:
Challenge: Low protein yield or formation of inclusion bodies
Solution: Optimize expression conditions (temperature, IPTG concentration, culture media)
Alternative: Consider fusion partners (MBP, SUMO) to enhance solubility
Protein Stability Concerns:
Challenge: Protein degradation during purification or storage
Solution: Add protease inhibitors during purification and 6% Trehalose in storage buffer
Best practice: Store in aliquots at -20°C/-80°C and avoid repeated freeze-thaw cycles
Activity Assessment:
Challenge: Confirming biological activity of the recombinant protein
Solution: Develop functional assays relevant to rnasek-a's ribonuclease activity
Approach: Compare with native protein where possible
Reconstitution Protocol:
Challenge: Protein aggregation upon reconstitution
Solution: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Recommendation: Add 5-50% glycerol for long-term storage
These challenges require careful optimization of protocols for successful production and use of functional recombinant rnasek-a protein .
To optimize detection of low-abundance transcripts like rnasek-a in RNA-seq experiments:
Sequencing Depth Considerations:
Increase sequencing depth to >30 million reads per sample for low-abundance transcripts
Focus on paired-end sequencing to improve mapping accuracy
Consider target enrichment approaches for focused analysis
Library Preparation Strategy:
Select rRNA depletion over poly-A selection if studying non-polyadenylated transcripts
Use library preparation methods designed for low-input samples if material is limited
Consider strand-specific protocols to distinguish overlapping transcripts
Experimental Design Enhancements:
Increase biological replicates (5-6 rather than standard 3) to improve statistical power
Include tissue-specific or cell-type-specific enrichment where possible
Consider time-course analysis to capture transient expression changes
Computational Analysis Adjustments:
Use analysis tools optimized for detection of low-abundance transcripts
Implement variance stabilizing transformations appropriate for low-count data
Consider Bayesian approaches that can better handle low counts
These optimizations collectively improve detection sensitivity and quantification accuracy for low-abundance transcripts, allowing more reliable analysis of rnasek-a expression patterns .
When investigating rnasek-a function in RNA processing, include these essential controls:
Knockdown/Knockout Controls:
Multiple shRNA or morpholino constructs targeting different regions of rnasek-a
Non-targeting shRNA or morpholino with similar chemistry
Rescue experiments with RNAi-resistant rnasek-a to confirm specificity
Subcellular Localization Studies:
Empty vector controls for fluorescent protein fusions
Co-staining with established organelle markers
Antibody-only controls for immunofluorescence
RNA Processing Assays:
Positive controls using known RNA processing factors (e.g., hnRNPs)
Negative controls using proteins not involved in RNA processing
Substrate RNAs with mutations in potential binding sites
Evolutionary Comparisons:
Parallel studies of both rnasek-a and rnasek-b to identify paralog-specific functions
Cross-species experiments to determine conserved vs. species-specific functions
Chimeric constructs to identify functionally important domains
These controls ensure experimental rigor and help distinguish specific effects of rnasek-a from non-specific or secondary effects .