Recombinant Xenopus laevis Ribonuclease kappa-A (rnasek-a)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence and Tagging

The full-length protein (1–101 amino acids) includes an N-terminal His-tag for affinity purification. The primary sequence is:
MVSLLCCGPKLAACGIVISVWGVIMLILLGVFFNVHSAVLIEDVPFTEEDIFEDPNPPAK MYRLYEQVSYNCFIAAAIYIVLGGFSFCQVRLNKRKEYMVR .

FeatureDescription
Source OrganismXenopus laevis (African clawed frog)
Expression HostE. coli
TagN-terminal His-tag
Protein Length101 amino acids (full-length)
Purity>90% (SDS-PAGE confirmed)

Expression and Purification

The recombinant protein is produced via bacterial expression in E. coli, followed by His-tag affinity chromatography. Key biochemical properties include:

PropertySpecification
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 50% glycerol for long-term storage

Enzymatic Activity

RNASEK-a exhibits endoribonuclease activity, preferentially cleaving ApU and ApG phosphodiester bonds . The enzyme’s catalytic activity is dependent on an intramolecular disulfide bond between cysteine residues (e.g., Cys6 and Cys69 in human RNASEK) .

Immune Response and Apoptosis

Studies in grass carp CIK cells demonstrate that RNASEK-a overexpression:

  1. Upregulates Type I IFN:

    • IFN mRNA levels increased by 2.49-fold .

    • Protein expression enhanced by 1.32-fold (immunofluorescence) .

  2. Promotes Apoptosis:

    • Bax/Bcl-2 mRNA ratio elevated by 1.45-fold .

    • DNA fragmentation and TUNEL-positive apoptotic cells observed .

Experimental ModelEffect of RNASEK-a OverexpressionReference
CIK Cells1.93× increase in TUNEL-positive apoptotic cells
CL Cells1.29–1.43× elevation in Bax/Bcl-2 ratio

Pathway Activation

RNASEK-a activates eIF2α phosphorylation, a marker of cellular stress and apoptosis . This mechanism is critical in regulating cell survival under viral or pathogenic stress.

Cellular Localization and Pathways

In grass carp, RNASEK-a localizes to endosomes and the endoplasmic reticulum, suggesting roles in RNA processing and immune signaling . While Xenopus rnasek-a’s precise pathways are uncharacterized, homology to human RNASEK implicates involvement in:

  • RNA degradation: Regulation of mRNA stability.

  • Viral defense: Modulation of endocytic pathways for viral entry .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rnasek-a; Ribonuclease kappa-A; RNase K-A; RNase kappa-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rnasek-a
Target Protein Sequence
MVSLLCCGPKLAACGIVISVWGVIMLILLGVFFNVHSAVLIEDVPFTEEDIFEDPNPPAK MYRLYEQVSYNCFIAAAIYIVLGGFSFCQVRLNKRKEYMVR
Uniprot No.

Target Background

Function
Ribonuclease kappa-A (RNaseK-A) is an endoribonuclease from Xenopus laevis that preferentially cleaves ApU and ApG phosphodiester bonds.
Database Links

KEGG: xla:100037220

UniGene: Xl.75276

Protein Families
RNase K family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is recombinant rnasek-a typically produced for research purposes?

Recombinant Xenopus laevis rnasek-a is typically produced using E. coli expression systems. The process involves:

  • Cloning the full-length coding sequence (1-101aa) into an appropriate expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming the construct into E. coli

  • Inducing protein expression under optimized conditions

  • Purifying using affinity chromatography

  • Lyophilizing the protein for storage

The purified protein typically has greater than 90% purity as determined by SDS-PAGE and is stored as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What are the recommended storage and handling conditions for recombinant rnasek-a?

For optimal stability and activity of recombinant rnasek-a:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freezing and thawing

These conditions maintain protein stability and activity for research applications .

How should I design an RNA-seq experiment to study rnasek-a expression in Xenopus development?

When designing an RNA-seq experiment to study rnasek-a expression during Xenopus development:

  • Sample Selection: Include multiple developmental stages (e.g., NF48, NF54, NF59, and NF66) to capture expression changes during metamorphosis

  • Replication: Use at least 3 biological replicates per condition to ensure statistical power

  • Sequencing Parameters:

    • Depth: 20-30 million reads per sample for differential expression analysis

    • Read length: ≥75bp paired-end reads for better transcript reconstruction

    • Library preparation: Use methods that capture full-length transcripts

  • Controls: Include appropriate stage-matched controls and consider tissue-specific analysis

  • Analysis Pipeline: Plan for quality control, read alignment to Xenopus laevis v10.1 genome, quantification, and differential expression analysis

This approach will provide robust data on rnasek-a expression patterns across development .

What are the critical considerations for experimental design when studying RNA-binding proteins like rnasek-a?

When studying RNA-binding proteins such as rnasek-a, consider these critical experimental design factors:

  • Sources of Variability:

    • Biological variability between animals

    • Technical variability from library preparation (largest source)

    • Batch effects during sequencing

    • Read depth variations affecting detection of lowly expressed genes

  • Core Design Principles:

    • Replication: Use sufficient biological replicates (minimum 3)

    • Randomization: Randomize samples during preparation and sequencing

    • Blocking: Process samples in balanced batches to control for technical variation

  • Specific Considerations for RNA-binding Proteins:

    • Include enrichment methods (e.g., CLIP-seq) to identify direct RNA targets

    • Consider alternative splicing analysis pipelines

    • Compare expression with known targets to validate function

  • Preliminary Questions to Address:

    • Why do you expect differential expression in your tissue of interest?

    • What types of genes might be regulated by rnasek-a?

    • What are potential sources of variability in your experimental system?

Following these guidelines will maximize data quality and interpretability .

What techniques can be used to investigate rnasek-a's subcellular localization and interactions?

To investigate subcellular localization and interactions of rnasek-a, consider these methodological approaches:

  • Fluorescent Protein Fusion Constructs:

    • Create pEGFP-RNASEK-a constructs for live-cell imaging

    • Transfect into appropriate cell lines and observe localization patterns

    • Co-transfect with organelle markers like mitochondria, lysosome, or ER trackers

  • Co-localization Studies:

    • Use p3×FLAG-RNASEK-a with fluorescently tagged potential interactors

    • Perform immunofluorescence with anti-FLAG antibodies

    • Analyze colocalization with endosomal markers (e.g., pDsRed2-Rab5/7)

  • Interaction Partner Identification:

    • Immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

  • Functional Genomics:

    • RNA interference using shRNA (e.g., shRNASEK designs)

    • CRISPR-Cas9 for gene knockout studies

    • Rescue experiments with mutant constructs

These approaches can be combined to build a comprehensive picture of rnasek-a's cellular function and interaction network .

What roles do RNA-binding proteins like rnasek-a play in Xenopus development?

RNA-binding proteins, including ribonucleases like rnasek-a, play critical roles in Xenopus development:

  • Neural Development: RNA-binding proteins are enriched in expression cloning screens from the neural plate, suggesting essential functions in nervous system development

  • RNA Splicing Regulation: They participate in selective RNA splicing and metabolism, which appears particularly important in early central nervous system development

  • Developmental Transitions: RNA-binding proteins often regulate transcript stability during metamorphosis and other developmental transitions

  • Tissue-Specific Expression: Many RNA-binding proteins show tissue-specific expression patterns, with heterogeneous nuclear ribonucleoproteins (hnRNPs) and Serine/Arginine-rich proteins (SR-proteins) being particularly prevalent

  • Multiple Functions: They contribute to exon definition, alternative splicing, nuclear export of RNA, and mRNA stability

The prevalence of RNA-binding proteins in developmental screens suggests that post-transcriptional regulation is a major mechanism controlling gene expression during embryogenesis .

How is RNA splicing regulated in Xenopus, and what role might rnasek-a play?

RNA splicing in Xenopus is regulated through complex mechanisms with potential involvement of rnasek-a:

  • Essential Splicing Machinery: U1-RNP complexes are critical for intron removal in Xenopus. Antisera against ribonucleoproteins containing U1 small nuclear RNA (Sm and RNP) inhibit splicing of ribosomal protein RNAs when injected into Xenopus oocytes

  • Developmental Regulation: Splicing patterns change throughout development, particularly during metamorphosis when extensive tissue remodeling occurs

  • Tissue-Specific Factors: RNA-binding proteins, potentially including rnasek-a, may contribute to tissue-specific splicing patterns

  • Paralogs and Functional Diversity: The existence of paralog proteins (e.g., RNASEK-a and RNASEK-b) suggests specialized functions in different contexts or tissues

  • Potential rnasek-a Function: Based on its classification as a ribonuclease, rnasek-a may participate in RNA processing pathways that affect splicing efficiency or specificity, though direct evidence in Xenopus is limited

Understanding the role of rnasek-a specifically will require further functional studies using techniques like antisense oligonucleotides or CRISPR-mediated knockout .

How can single-cell RNA-seq be used to study rnasek-a expression across cell types in Xenopus?

Single-cell RNA-seq offers powerful approaches to study rnasek-a expression across different cell types:

  • Xenopus Cell Landscape Resource: The recently developed Xenopus Cell Landscape (XCL) provides a valuable reference comprising more than 500,000 cells isolated from four developmental stages and 17 adult tissues, profiling over 100 major cell types

  • Methodological Approach:

    • Tissue dissociation using appropriate protocols for your tissue of interest

    • Single-cell isolation using Microwell-seq or other single-cell platforms

    • Library preparation and sequencing (10X Genomics platform is commonly used)

    • Computational analysis including quality control, dimensionality reduction, clustering, and cell type annotation

  • Analysis Strategy for rnasek-a:

    • Map expression across identified cell clusters

    • Perform trajectory analysis to track expression changes during development

    • Correlate expression with known markers of cell types and states

    • Identify co-expressed genes for pathway analysis

  • Comparative Analysis:

    • Compare rnasek-a expression patterns with other vertebrate models

    • Analyze expression of both paralogs (rnasek-a and rnasek-b) to identify differential regulation

    • Integrate with bulk RNA-seq data for validation

This approach can reveal cell type-specific functions and regulatory networks involving rnasek-a .

How do paralog proteins RNASEK-a and RNASEK-b differ in structure and function?

RNASEK-a and RNASEK-b are paralog proteins that show both structural similarities and functional differences:

  • Genomic Organization:

    • Both genes can be amplified from genomic DNA and total RNA

    • The genomic structure shows some differences reflecting their divergence after duplication

  • Sequence Comparison:

    • Both proteins maintain the core ribonuclease domain

    • Specific sequence variations likely account for functional differences

    • Comparative analysis of CDS regions can reveal selection pressures on each paralog

  • Subcellular Localization:

    • Studies using pEGFP-RNASEK-a and pEGFP-RNASEK-b constructs reveal distinct but overlapping localization patterns

    • Co-localization experiments with p3×FLAG-RNASEK-a and pEGFP-RNASEK-b show interaction potential

  • Functional Divergence:

    • In fish, both paralogs enhance Type I interferon responses

    • Knockdown experiments using shRNASEK constructs demonstrate specialized functions

    • Different expression patterns during development suggest tissue-specific roles

This paralog divergence represents an example of subfunctionalization and/or neofunctionalization following gene duplication, contributing to the complexity of RNA processing mechanisms .

What evolutionary insights can be gained from studying ribonucleases across vertebrates?

Studying ribonucleases like rnasek-a across vertebrates provides valuable evolutionary insights:

  • Cross-Species Conservation:

    • The Xenopus Cell Landscape (XCL) resource enables comparison with Human Cell Landscape (HCL), Mouse Cell Atlas (MCA), and Zebrafish Cell Landscape (ZCL)

    • Endothelial and stromal cells show strongest cross-species correlation in gene expression patterns

    • Germline of Xenopus shows strongest correlation with zebrafish, weaker with mouse, and minimal with human

  • Adaptation to Environmental Transitions:

    • Xenopus undergoes transition from aquatic to terrestrial environments during metamorphosis

    • RNA processing proteins may play crucial roles in the extensive transcriptional changes during this transition

    • Comparing lung cell types reveals differences in respiratory adaptations (e.g., Xenopus lacks clear AT1 cells but has enriched pulmonary ionocytes)

  • Genome Evolution in Xenopus:

    • Xenopus laevis has a pseudotetraploid genome, often with two copies of genes (e.g., "L" and "S" homeologs)

    • Some ribosomal protein genes show population polymorphism

    • Recombinant protein studies reveal gene copy variations (2 copies for r-proteins L1, L14, S19 and 4-5 copies for S1, S8, L32)

These comparative analyses reveal how RNA processing mechanisms have evolved to support species-specific developmental programs while maintaining core functionalities .

What techniques can be used to study the role of rnasek-a in RNA metabolism?

Advanced techniques to study rnasek-a's role in RNA metabolism include:

  • RNA Immunoprecipitation (RIP) and Sequencing:

    • Use antibodies against rnasek-a to pull down bound RNAs

    • Sequence recovered RNAs to identify direct targets

    • Analyze binding motifs and structural preferences

  • CRISPR/Cas9 Gene Editing:

    • Create knockout or knockin models in Xenopus

    • Design gRNAs targeting conserved domains

    • Analyze resulting phenotypes focusing on RNA processing defects

  • Ribosome Profiling:

    • Measure translation efficiency of transcripts in presence vs. absence of rnasek-a

    • Identify mRNAs whose translation is specifically affected

  • In Vivo Splicing Assays:

    • Inject antisera or morpholinos targeting rnasek-a into Xenopus oocytes

    • Analyze splicing patterns of reporter constructs or endogenous transcripts

    • Compare with known splicing inhibitors (e.g., anti-U1 snRNP antibodies)

  • Biochemical Assays:

    • Express and purify recombinant rnasek-a

    • Test RNA processing activity on synthetic substrates

    • Perform structure-function analyses with mutated proteins

These complementary approaches can provide comprehensive insights into rnasek-a's molecular function in RNA metabolism and developmental regulation .

What are common challenges in producing and working with recombinant rnasek-a protein?

Researchers frequently encounter these challenges when working with recombinant rnasek-a:

  • Expression and Solubility Issues:

    • Challenge: Low protein yield or formation of inclusion bodies

    • Solution: Optimize expression conditions (temperature, IPTG concentration, culture media)

    • Alternative: Consider fusion partners (MBP, SUMO) to enhance solubility

  • Protein Stability Concerns:

    • Challenge: Protein degradation during purification or storage

    • Solution: Add protease inhibitors during purification and 6% Trehalose in storage buffer

    • Best practice: Store in aliquots at -20°C/-80°C and avoid repeated freeze-thaw cycles

  • Activity Assessment:

    • Challenge: Confirming biological activity of the recombinant protein

    • Solution: Develop functional assays relevant to rnasek-a's ribonuclease activity

    • Approach: Compare with native protein where possible

  • Reconstitution Protocol:

    • Challenge: Protein aggregation upon reconstitution

    • Solution: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Recommendation: Add 5-50% glycerol for long-term storage

These challenges require careful optimization of protocols for successful production and use of functional recombinant rnasek-a protein .

How can I optimize RNA-seq experimental design to detect low-abundance transcripts like rnasek-a?

To optimize detection of low-abundance transcripts like rnasek-a in RNA-seq experiments:

  • Sequencing Depth Considerations:

    • Increase sequencing depth to >30 million reads per sample for low-abundance transcripts

    • Focus on paired-end sequencing to improve mapping accuracy

    • Consider target enrichment approaches for focused analysis

  • Library Preparation Strategy:

    • Select rRNA depletion over poly-A selection if studying non-polyadenylated transcripts

    • Use library preparation methods designed for low-input samples if material is limited

    • Consider strand-specific protocols to distinguish overlapping transcripts

  • Experimental Design Enhancements:

    • Increase biological replicates (5-6 rather than standard 3) to improve statistical power

    • Include tissue-specific or cell-type-specific enrichment where possible

    • Consider time-course analysis to capture transient expression changes

  • Computational Analysis Adjustments:

    • Use analysis tools optimized for detection of low-abundance transcripts

    • Implement variance stabilizing transformations appropriate for low-count data

    • Consider Bayesian approaches that can better handle low counts

These optimizations collectively improve detection sensitivity and quantification accuracy for low-abundance transcripts, allowing more reliable analysis of rnasek-a expression patterns .

What controls should be included when studying rnasek-a function in RNA processing?

When investigating rnasek-a function in RNA processing, include these essential controls:

  • Knockdown/Knockout Controls:

    • Multiple shRNA or morpholino constructs targeting different regions of rnasek-a

    • Non-targeting shRNA or morpholino with similar chemistry

    • Rescue experiments with RNAi-resistant rnasek-a to confirm specificity

  • Subcellular Localization Studies:

    • Empty vector controls for fluorescent protein fusions

    • Co-staining with established organelle markers

    • Antibody-only controls for immunofluorescence

  • RNA Processing Assays:

    • Positive controls using known RNA processing factors (e.g., hnRNPs)

    • Negative controls using proteins not involved in RNA processing

    • Substrate RNAs with mutations in potential binding sites

  • Evolutionary Comparisons:

    • Parallel studies of both rnasek-a and rnasek-b to identify paralog-specific functions

    • Cross-species experiments to determine conserved vs. species-specific functions

    • Chimeric constructs to identify functionally important domains

These controls ensure experimental rigor and help distinguish specific effects of rnasek-a from non-specific or secondary effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.