Recombinant Xenopus laevis Ribonuclease kappa-B (rnasek-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
rnasek-b; Ribonuclease kappa-B; RNase K-B; RNase kappa-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rnasek-b
Target Protein Sequence
MVSLLCCGPKLAACGIVLSVWGVIMLVLLGVFFNVHSAVLIEDVPFTEADMFEDPNPPAK MYRLYEQVSYNCFIAAAIYIVLGGFSFCQVRLNKRKEYMVR
Uniprot No.

Target Background

Function
Endoribonuclease that preferentially cleaves ApU and ApG phosphodiester bonds.
Database Links

KEGG: xla:779185

UniGene: Xl.34571

Protein Families
RNase K family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Ribonuclease kappa-B (rnasek-b) and how is it characterized in Xenopus models?

Ribonuclease kappa-B (rnasek-b) belongs to the ribonuclease kappa family of proteins. While specific Xenopus laevis characterization is limited in current literature, related studies in fish show that RNASEK paralogs (RNASEK-a and RNASEK-b) function as positive regulators of type I interferon and apoptosis . For Xenopus researchers, characterization would likely involve:

  • Sequence identification through homology searches using known RNASEK sequences

  • Cloning the CDS region through PCR amplification from Xenopus cDNA

  • Comparative genomic analysis against other vertebrate RNASEK orthologs

  • Expression pattern analysis across developmental stages and tissues

The protein is predicted to have endoribonuclease activity and localize to membranes, similar to zebrafish rnasekb .

How does the genomic organization of rnasek-b typically appear in vertebrates?

Based on studies in other vertebrates, researchers investigating Xenopus rnasek-b should expect:

  • A relatively small gene containing multiple exons

  • Conservation of key functional domains, particularly the ribonuclease kappa domain (IPR026770)

  • Potential paralogs resulting from genome duplication events common in vertebrates

  • Genomic context that may be conserved across vertebrate lineages

When studying gene organization in Xenopus, techniques similar to those used for other r-proteins would be applicable, including genomic DNA isolation, PCR amplification, and sequence analysis as demonstrated in studies of other Xenopus ribosomal proteins .

What expression patterns would be expected for rnasek-b in Xenopus laevis?

While specific Xenopus expression data is not detailed in the current literature, researchers should consider:

  • Using RT-PCR, in situ hybridization, or RNA-seq approaches to map expression across developmental stages

  • Creating transgenic reporter lines using techniques established for Xenopus

  • Comparing expression patterns with those observed in other vertebrates

  • Analyzing potential differential expression between tissues, particularly in immune-relevant tissues

Xenopus model systems offer excellent platforms for such studies, with established transgenic methodologies and centralized resources supporting such investigations .

What are optimal cloning strategies for recombinant Xenopus laevis rnasek-b expression?

Based on successful approaches with related proteins, researchers should consider:

  • RNA Isolation and cDNA Synthesis:

    • Extract total RNA from appropriate Xenopus tissues (oocytes or embryonic stages)

    • Enrich for poly-A+ mRNA if targeting higher expression levels

    • Synthesize cDNA using reverse transcriptase with oligo-dT primers

  • PCR Amplification Protocol:

    • Design primers specific to predicted Xenopus rnasek-b sequences

    • Use a PCR program similar to: 95°C for 3 min, followed by 35 cycles of 95°C for 30s, 55°C for 30s, and 72°C for 30s, with final elongation at 72°C for 10 min

    • Confirm amplicon size by agarose gel electrophoresis

  • Cloning Strategy:

    • Clone PCR products into pEASY-T1 vectors or similar for sequence verification

    • Subclone verified sequences into appropriate expression vectors (pcDNA3.1, pEGFP, or p3×FLAG) for functional studies

    • Confirm recombinants through restriction digest and sequencing

What experimental approaches are effective for studying rnasek-b subcellular localization?

Recommended approaches include:

  • Fluorescent Fusion Proteins:

    • Generate pEGFP-RNASEK-b fusion constructs for live imaging

    • Use p3×FLAG-RNASEK-b for antibody-based detection methods

    • Consider dual-labeling with pEGFP-RNASEK-b and p3×FLAG-RNASEK-a to study potential colocalization

  • Organelle Colocalization Studies:

    • Combine EGFP-tagged rnasek-b with markers for specific organelles:

      • Mitochondria (MitoTracker Red)

      • Lysosomes (Lyso-Tracker Red)

      • Endoplasmic reticulum (ER-Tracker Red)

    • Co-express with markers of endosomal compartments (pDsRed2-Rab5/7)

  • Tissue-Specific Expression:

    • Utilize Xenopus transgenic approaches with tissue-specific promoters

    • Take advantage of established Xenopus transgenic resources

What methods are recommended for rnasek-b loss-of-function studies in Xenopus?

Researchers should consider these approaches:

  • shRNA-Mediated Knockdown:

    • Design multiple shRNAs targeting different regions of the rnasek-b sequence

    • Clone shRNAs into vectors like pGPU6/Neo or PLKO-U6-PGK-mCherry

    • Include appropriate non-targeting shRNA controls

    • Validate knockdown efficiency using RT-qPCR and western blot

  • CRISPR-Cas9 Gene Editing:

    • Design sgRNAs targeting exonic regions of rnasek-b

    • Leverage Xenopus's high efficiency for gene editing

    • Create stable knockout lines for comprehensive functional studies

    • Verify mutations using sequencing and functional assays

  • Morpholino Antisense Oligonucleotides:

    • Design morpholinos targeting the start codon or splice junctions

    • Inject into Xenopus embryos at early developmental stages

    • Include control morpholinos and rescue experiments for validation

How might rnasek-b function in viral infection processes in Xenopus models?

Based on studies of RNASEK in other systems, researchers should investigate:

  • Viral Entry Mechanisms:

    • RNASEK has been shown to be essential for infection by diverse enveloped viruses that enter cells through acid-dependent pathways

    • Test whether Xenopus rnasek-b is required for uptake but not binding of viruses

    • Examine specific involvement in clathrin-mediated endocytosis pathways for viruses

  • Virus-Host Interaction Studies:

    • Assess effects of rnasek-b knockdown/overexpression on viral replication in Xenopus cells

    • Compare effects across different virus families (Flaviviridae, Togaviridae, Bunyaviridae, Orthomyxoviridae)

    • Determine specificity for acid-dependent viral entry pathways versus plasma membrane entry

  • Experimental Design Considerations:

    • Include both acid-dependent viruses and those entering via plasma membrane as controls

    • Perform binding assays to distinguish between attachment and internalization defects

    • Include transferrin uptake assays as controls for general endocytosis

What role might rnasek-b play in Xenopus immune responses?

Drawing from studies in fish models, researchers should investigate:

  • Type I Interferon Regulation:

    • Fish RNASEK-a and -b enhance type I interferon secretion

    • Assess whether Xenopus rnasek-b modulates IFN expression in response to viral challenge

    • Examine the relationship between rnasek-b and IRF3/IRF7 phosphorylation

  • Apoptotic Pathways:

    • Determine if rnasek-b promotes apoptosis in Xenopus cells as observed in fish

    • Measure apoptotic markers (DNA fragmentation, TUNEL-positive cells, Annexin V signals)

    • Investigate the relationship with eIF2α phosphorylation

  • Experimental Approaches:

    • Generate rnasek-b overexpression and knockdown Xenopus cell lines

    • Perform qRT-PCR to measure IFN and related gene expression

    • Use western blotting to assess phosphorylation of signaling proteins

    • Employ flow cytometry to quantify apoptotic responses

How can recombinant rnasek-b be applied in Xenopus-based research models?

Potential applications include:

  • Viral Pathogenesis Studies:

    • Use Xenopus models with manipulated rnasek-b expression to study viral entry mechanisms

    • Develop transgenic Xenopus lines with fluorescently tagged rnasek-b to visualize viral entry in vivo

    • Explore potential as an antiviral therapeutic target

  • Endosomal Transport Research:

    • Investigate rnasek-b interactions with endosomal proteins like Rab5 and Rab7

    • Examine specific roles in endosomal acidification processes

    • Study potential interactions with V-ATPase components

  • Comparative Immunology:

    • Use Xenopus rnasek-b studies to bridge understanding between fish and mammalian systems

    • Leverage Xenopus as a tetrapod model with well-characterized immune system

How conserved is rnasek-b across vertebrate species?

Researchers interested in evolutionary aspects should:

  • Perform Comparative Sequence Analysis:

    • RNASEK is highly conserved with 51% homology between Drosophila and humans

    • Conduct multiple sequence alignments of rnasek-b across vertebrates

    • Identify conserved functional domains and motifs

    • Generate phylogenetic trees to visualize evolutionary relationships

  • Genomic Structure Comparison:

    • Compare exon-intron organization across species

    • Analyze syntenic relationships to identify conserved genomic contexts

    • Examine copy number variations (some r-proteins show 2-5 copies per haploid genome in Xenopus)

  • Functional Conservation Testing:

    • Assess whether rnasek-b from different species can functionally complement each other

    • Test cross-species rescue experiments in knockdown/knockout models

What differences might exist between rnasek-a and rnasek-b in Xenopus?

Based on observations in fish paralogs, researchers should investigate:

  • Sequence and Structural Comparisons:

    • Perform detailed sequence alignments between the paralogs

    • Identify differentially conserved residues that might indicate functional divergence

    • Model protein structures to predict functional differences

  • Expression Pattern Analysis:

    • Compare tissue distribution and developmental timing of expression

    • Analyze potential differential responses to stimuli (viral infection, immune activation)

    • Assess subcellular localization differences

  • Functional Redundancy Assessment:

    • Test whether knockdown of one paralog can be compensated by the other

    • Perform double knockdown experiments to identify synergistic effects

    • Investigate potential paralog-specific protein interactions

What are the technical challenges in studying rnasek-b in Xenopus models?

Researchers should be aware of these potential challenges:

  • Small Protein Size Considerations:

    • RNASEK is a small protein (approximately 137 amino acids in humans)

    • This may present difficulties in:

      • Antibody generation and specificity validation

      • Protein detection on western blots

      • Distinguishing between closely related paralogs

  • Functional Redundancy Issues:

    • Potential compensation between rnasek-a and rnasek-b

    • Possible existence of additional paralogs due to Xenopus genome duplication

    • Need for combinatorial knockdown/knockout approaches

  • Methodological Recommendations:

    • Use epitope tagging strategies (FLAG, HA, V5) for detection

    • Design paralog-specific reagents targeting divergent regions

    • Consider Xenopus laevis (allotetraploid) versus Xenopus tropicalis (diploid) for genetic studies

What are promising future research directions for rnasek-b in Xenopus?

Several areas warrant further investigation:

  • Detailed Mechanistic Studies:

    • Precise role in viral entry pathways

    • Molecular mechanisms of interferon enhancement

    • Characterization of protein-protein interactions in endosomal compartments

  • Therapeutic Applications:

    • Potential as an antiviral target against diverse virus families

    • Development of inhibitors targeting conserved functions

    • Testing in Xenopus disease models

  • Developmental Biology Applications:

    • Roles in embryonic development beyond immune function

    • Potential involvement in cellular stress responses

    • Connections to broader RNA metabolism pathways

What experimental systems are ideal for studying rnasek-b structure-function relationships?

Researchers should consider:

  • Recombinant Protein Analysis:

    • Express in bacterial or insect cell systems for structural studies

    • Use site-directed mutagenesis to identify critical residues

    • Perform in vitro enzymatic assays to characterize ribonuclease activity

  • Advanced Imaging Approaches:

    • Super-resolution microscopy of fluorescently tagged proteins

    • Live cell imaging in Xenopus cells and embryos

    • Correlative light and electron microscopy for precise localization

  • Proteomics Integration:

    • Identify interaction partners through immunoprecipitation-mass spectrometry

    • Map post-translational modifications affecting function

    • Characterize rnasek-b-containing protein complexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.