Recombinant Xenopus laevis RING finger protein 170 (rnf170)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnf170; E3 ubiquitin-protein ligase RNF170; RING finger protein 170; RING-type E3 ubiquitin transferase RNF170
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rnf170
Target Protein Sequence
MADNQEERPHFPLDEGSIIEGVSDQVIVVVLLSFVAVGSLIYLLLRNDEQNIHPENQDRV RAVREQLQNEQETPAPPRPQFYSDMTCPVCLQQATFPVETNCGHLFCGSCIIAYWRYGTW LGAINCPICRQTVTLLFPLFGATDQEDAQNILQEATGYNRRFSGQPRSLMDRIMDLPTLL RHAFREMFSVGGLFWMFRIRIVLCLLGALLYLVSPLDIIPEALFGILGFLDDLFVLFLLL IYISIMYREVVTQRLYR
Uniprot No.

Target Background

Function

Recombinant Xenopus laevis RING finger protein 170 (RNF170) is an E3 ubiquitin-protein ligase crucial for stimulus-induced ubiquitination and degradation of inositol 1,4,5-trisphosphate receptors (ITPRs) via the endoplasmic reticulum-associated degradation (ERAD) pathway. It also plays a role in ITPR turnover under basal conditions.

Database Links

KEGG: xla:496050

UniGene: Xl.49865

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the functional role of RNF170 in Xenopus laevis?

RNF170 in Xenopus laevis functions as an E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor (ITPR) ubiquitination and degradation via the endoplasmic reticulum-associated degradation pathway . This protein contains a RING domain that is critical for its ubiquitin ligase activity. The primary cellular function involves regulating calcium signaling through control of IP3R levels, which affects numerous developmental and physiological processes in the amphibian model system. Comparative analysis with mammalian homologs suggests conservation of this critical regulatory function across vertebrate evolution.

How is rnf170 expression regulated during Xenopus development?

During Xenopus development, rnf170 expression follows a specific temporal and spatial pattern that correlates with key developmental transitions. While comprehensive expression data for rnf170 is still emerging, the protein appears to be expressed throughout embryonic development and in adult tissues . Gene expression may be regulated by tissue-specific transcription factors and developmental signals that control calcium signaling pathways. Researchers can analyze expression patterns using in situ hybridization, RT-PCR, or RNA-seq techniques during different developmental stages to establish the complete expression profile and identify regulatory mechanisms.

What are the key structural domains of recombinant Xenopus laevis RNF170?

Recombinant Xenopus laevis RNF170 contains several key structural domains that are essential for its function. The protein features a RING finger domain critical for its E3 ubiquitin ligase activity, along with multiple transmembrane domains that anchor it to the endoplasmic reticulum membrane . The RING domain contains characteristic cysteine and histidine residues that coordinate zinc ions and facilitate interaction with ubiquitin-conjugating enzymes (E2s). Additionally, RNF170 contains regions necessary for substrate recognition, particularly for binding to the inositol 1,4,5-trisphosphate receptor. Commercial recombinant preparations typically achieve ≥85% purity as determined by SDS-PAGE analysis .

How do mutations in Xenopus rnf170 affect IP3R degradation and calcium signaling?

Mutations in rnf170 significantly impair IP3R degradation, leading to accumulation of IP3R in cellular systems. In human patient-derived fibroblasts with RNF170 mutations, IP3R-3 levels were increased 2.2-3.8-fold compared to controls, and bradykinin-induced degradation of IP3R was completely abolished . Similar effects would be expected in Xenopus systems with rnf170 mutations. The accumulation of IP3R likely alters intracellular calcium signaling dynamics by increasing the potential for IP3-mediated calcium release from the endoplasmic reticulum. This dysregulation may have profound effects on calcium-dependent cellular processes such as gene expression, cell division, and neuronal function.

What experimental approaches can differentiate the functions of rnf170.L and rnf170.S homeologs in Xenopus laevis?

Xenopus laevis, being allotetraploid, typically has two homeologs of many genes including potentially rnf170.L and rnf170.S. Researchers can employ several approaches to differentiate their functions:

  • CRISPR/Cas9-mediated knockout of specific homeologs using sequence-specific guide RNAs

  • Homeolog-specific morpholino oligonucleotides for targeted knockdown

  • RNA-seq analysis to quantify differential expression patterns across tissues and developmental stages

  • Promoter analysis to identify homeolog-specific regulatory elements

  • Rescue experiments using recombinant proteins to determine functional redundancy

When designing experiments, researchers should create homeolog-specific PCR primers targeting unique 3' UTR regions to verify knockout/knockdown efficiency and to monitor differential expression patterns. Functional assays measuring IP3R levels and calcium signaling can then be employed to detect potential subfunctionalization between homeologs.

What are the optimal expression systems for producing functional recombinant Xenopus laevis RNF170?

Multiple expression systems can be utilized for producing functional recombinant Xenopus laevis RNF170, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical YieldPost-translational Modifications
E. coliCost-effective, high yield, rapid productionLimited post-translational modifications, potential for inclusion bodies5-50 mg/LMinimal
Yeast (P. pastoris)Eukaryotic processing, secretion possibleLonger production time, different glycosylation patterns1-10 mg/LBasic glycosylation
Baculovirus/InsectNear-native folding, most PTMsHigher cost, technical complexity1-20 mg/LMost mammalian-like PTMs
Mammalian Cell LinesNative-like PTMs, proper foldingHighest cost, lowest yield0.1-5 mg/LComplete, native-like PTMs

For transmembrane proteins like RNF170, mammalian or insect cell expression systems are often preferred to ensure proper membrane insertion and folding . Cell-free expression systems represent an alternative approach for rapid protein production without cellular constraints. Purification typically achieves ≥85% purity as determined by SDS-PAGE, though higher purity may be necessary for structural studies or specific enzymatic assays .

What controls and validation steps are critical when studying Xenopus RNF170-mediated ubiquitination in vitro?

When studying RNF170-mediated ubiquitination in vitro, researchers should implement these critical controls and validation steps:

  • Enzyme Activity Controls:

    • Include catalytically inactive RNF170 mutant (RING domain mutation)

    • Perform reactions without ATP to confirm ATP-dependency

    • Include E1 and E2 only reactions to distinguish background activity

  • Substrate Validation:

    • Confirm IP3R specificity using mutant IP3R lacking RNF170 binding sites

    • Include non-substrate proteins to demonstrate specificity

    • Use immunoprecipitation followed by ubiquitin western blot to verify target-specific ubiquitination

  • Ubiquitination Chain Analysis:

    • Employ chain-specific antibodies to determine ubiquitin linkage types

    • Use mass spectrometry to identify precise ubiquitination sites

    • Include ubiquitin mutants (K48R, K63R) to confirm chain topology

  • System Reconstitution:

    • Verify complex formation between RNF170 and its E2 enzyme partner

    • Assess membrane dependence using detergent-solubilized versus membrane-embedded conditions

    • Test substrate concentration ranges to establish kinetic parameters

These controls ensure that observed ubiquitination is specific, physiologically relevant, and accurately attributed to RNF170 activity rather than experimental artifacts.

How can CRISPR/Cas9 be optimized for studying rnf170 function in Xenopus laevis embryos?

Optimizing CRISPR/Cas9 for studying rnf170 function in Xenopus laevis requires special considerations due to the tetraploid nature of this organism and the potential presence of homeologs. A methodological approach should include:

  • Guide RNA Design:

    • Design sgRNAs targeting conserved exons between homeologs for complete knockout

    • Alternatively, design homeolog-specific sgRNAs targeting unique regions for selective knockout

    • Use multiple sgRNAs to increase efficiency (typically 3-4 per target)

    • Verify sgRNA specificity using in silico tools to minimize off-target effects

  • Delivery Method:

    • Microinjection at 1-2 cell stage (typically 2-4 ng Cas9 protein with 200-400 pg sgRNA)

    • Consider using Cas9 protein rather than mRNA for faster action and reduced toxicity

    • For tissue-specific studies, use tissue-specific promoters driving Cas9 expression

  • Validation Strategy:

    • T7 endonuclease assay or direct sequencing of target regions

    • Western blot analysis to confirm protein reduction

    • Functional assays measuring IP3R accumulation

    • qPCR with homeolog-specific primers to verify knockout efficiency

  • Phenotypic Analysis Timeline:

    Developmental StageAnalysis FocusTechniques
    Blastula (stage 8-9)Early gene expression changesRNA-seq, qPCR
    Gastrula (stage 10-12)Morphogenetic movementsTime-lapse imaging
    Neurula (stage 14-20)Neural developmentIn situ hybridization, immunohistochemistry
    Tailbud (stage 25-35)Organogenesis, calcium signalingCalcium imaging, organ-specific markers
    Tadpole (stage 45+)Behavioral phenotypesVideo tracking, response assays

For rescue experiments, co-inject rnf170 mRNA resistant to CRISPR targeting to confirm phenotype specificity and rule out off-target effects.

How can Xenopus laevis rnf170 models inform our understanding of hereditary spastic paraplegia?

Xenopus laevis rnf170 models can significantly contribute to understanding hereditary spastic paraplegia (HSP) through several research approaches:

Biallelic mutations in RNF170 have been associated with autosomal recessive HSP in humans . Xenopus models can recapitulate these mutations through CRISPR/Cas9 genome editing to create disease-relevant phenotypes. The transparent nature of Xenopus embryos allows for in vivo visualization of neuronal development and calcium signaling dynamics in real-time. Researchers can monitor IP3R accumulation, which occurs when RNF170 function is compromised, and observe subsequent effects on calcium homeostasis and neuronal function .

Comparative analysis between wildtype and mutant phenotypes can reveal how specific mutations affect:

  • Neuronal development and axonal growth

  • Motor coordination and behavioral outcomes

  • Calcium signaling patterns in developing and mature neurons

  • Cellular stress responses in the endoplasmic reticulum

The relatively rapid development of Xenopus makes it possible to assess both acute and chronic effects of RNF170 dysfunction, providing insights into disease progression that may inform therapeutic strategies.

What are the key differences in IP3R regulation between Xenopus laevis RNF170 and zebrafish rnf170?

Comparative analysis between Xenopus laevis and zebrafish rnf170 reveals both conserved and divergent aspects of IP3R regulation:

Key differences may include:

  • Temporal expression patterns during embryonic development

  • Tissue-specific expression profiles

  • Sensitivity to calcium signaling perturbations

  • Interaction with species-specific regulatory proteins

Researchers investigating these differences should employ cross-species rescue experiments to determine functional equivalence. For example, introducing Xenopus rnf170 into zebrafish rnf170 morphants can reveal whether the amphibian protein can compensate for loss of the fish ortholog, providing insights into functional conservation versus specialization.

What emerging technologies could advance the study of Xenopus laevis RNF170 function in development and disease?

Several emerging technologies show particular promise for advancing RNF170 research:

  • Optogenetic Control of RNF170 Activity:
    Light-inducible RNF170 systems would allow precise temporal and spatial control of E3 ligase activity in developing embryos, enabling researchers to determine exactly when and where RNF170 function is required during development.

  • Single-Cell Proteomics:
    This technology could reveal cell-type specific differences in RNF170 expression and activity across tissues during development, identifying previously unknown roles in specific lineages.

  • Cryo-EM Structural Analysis:
    High-resolution structural studies of the RNF170-IP3R complex would provide mechanistic insights into substrate recognition and the ubiquitination process, potentially informing therapeutic design.

  • CRISPR Base Editing:
    More precise than traditional CRISPR/Cas9, base editing could introduce specific disease-associated mutations without creating double-strand breaks, allowing creation of subtle disease models.

  • Spatial Transcriptomics:
    This approach would map rnf170 expression with unprecedented spatial resolution throughout development, revealing potential correlation with developmental patterning genes.

These technologies, particularly when combined, could significantly advance our understanding of RNF170 biology and its implications for human disease states involving IP3R regulation and calcium signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.