Recombinant Xenopus laevis S-adenosylmethionine mitochondrial carrier protein (slc25a26)

Shipped with Ice Packs
In Stock

Description

Mitochondrial Methylation and Disease Links

  • SAM Transport Defects: Impaired SLC25A26 activity disrupts mitochondrial RNA methylation, leading to respiratory chain deficiencies and pathologies like lactic acidosis .

  • Cancer Relevance: Downregulation of SLC25A26 in cancers (e.g., cervical carcinoma) alters mitochondrial SAM/SAH ratios, impacting DNA methylation and chemotherapy sensitivity .

  • Model Organism Insights:

    • Drosophila and mouse models show that SAH transport impairment (not SAM) underlies late-onset mitochondrial myopathy .

    • Cardiac-specific Slc25a26 knockout in mice accelerates protein synthesis rates and exacerbates mitochondrial damage under stress .

Conservation Across Species

SpeciesGeneSubstrates TransportedKey Role
Xenopus laevisSLC25A26SAM ↔ SAHMethylation balance, heme biosynthesis .
HumanSLC25A26SAM ↔ SAHMitochondrial translation, CoQ synthesis .
YeastPET8SAM ↔ SAH/SACRespiration, methionine cycle .

Applications in Research

  • Mitochondrial Metabolism Studies: Used to investigate SAM-dependent processes like tRNA methylation and lipoic acid biosynthesis .

  • Therapeutic Development: Potential target for modulating mitochondrial dysfunction in cancers and metabolic disorders .

  • Comparative Biology: Provides insights into evolutionary conservation of SAM/SAH transport mechanisms .

Future Directions

While recombinant Xenopus laevis SLC25A26 is commercially available , direct studies on its biochemical kinetics and disease associations remain limited. Prioritizing Xenopus-specific assays could clarify its role in developmental biology and environmental stress responses, leveraging its utility as a model for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc25a26; samc; S-adenosylmethionine mitochondrial carrier protein; Mitochondrial S-adenosylmethionine transporter; Solute carrier family 25 member 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc25a26
Target Protein Sequence
MERRELCASLLAGGAAGMSVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGS FPNAAAFFVTYESAKRFLGSDSSYLSPIIHMAAAFLGELVACLIRVPSEVIKQRAQVSPS STTYQMLSVTLREEGIKGLYRGYKSTVLREIPFSLVQFPLWEFLKNLWSWKQGRAVDCWQ SAVCGAFAGGFAAAVTTPLDVAKTRIMLAKAGSGVANGNVLFALHEIWRTQGIMGLFAGV IPRMTMISLGGFIFLGAYDKVRSSLL
Uniprot No.

Target Background

Function
Mitochondrial solute carriers transport metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. Specifically, this protein mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.
Database Links

KEGG: xla:447740

UniGene: Xl.6675

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the SLC25A26 protein and what is its function in Xenopus laevis?

SLC25A26 is a mitochondrial carrier protein responsible for transporting S-adenosylmethionine (SAM) into the mitochondria. In Xenopus laevis, as in other species, this protein plays a crucial role in mitochondrial metabolism, particularly in processes involving methylation reactions within the mitochondria. The S-adenosylmethionine mitochondrial carrier protein is essential for maintaining proper mitochondrial function during various cellular processes, including development and regeneration .

How conserved is SLC25A26 across different species?

The SLC25A26 gene is highly conserved across various species, including yeast, fish, amphibians, and mammals. In Saccharomyces cerevisiae, the homolog was initially named Sam5p (now known as Pet8p) and is encoded by the PET8 gene . The conservation of this protein across diverse evolutionary lineages indicates its fundamental importance in cellular metabolism. Comparative analyses have identified SLC25A26 in humans, zebrafish (Danio rerio), and Xenopus laevis, suggesting an evolutionarily conserved functional role in mitochondrial SAM transport .

What experimental models are most suitable for studying Xenopus laevis SLC25A26?

Xenopus laevis provides an excellent model system for studying SLC25A26 due to its unique developmental characteristics and regenerative capabilities. The tadpole stages (NF stages 48-52) offer particular advantages for investigating the role of SLC25A26 in regeneration processes, as these stages exhibit remarkable regenerative abilities that are lost after metamorphosis (NF stage 66) . For in vitro studies, both primary cell cultures derived from Xenopus laevis tissues and recombinant protein expression systems using mammalian cells have proven effective .

What are the optimal expression systems for producing recombinant Xenopus laevis SLC25A26?

For producing recombinant Xenopus laevis SLC25A26, mammalian cell expression systems typically yield the highest quality protein with proper folding and post-translational modifications. Based on comparable recombinant protein production methods, the following expression parameters have proven effective:

Expression ParameterRecommended Conditions
Expression SystemMammalian cells (HEK293, CHO)
Purification TagHis-tag or His-Fc-Avi tag
Buffer SystemPBS (phosphate-buffered saline)
Storage ConditionsShort-term: +4°C; Long-term: -20°C to -80°C
Typical Purity>80% as determined by SDS-PAGE
Endotoxin Level<1.0 EU per μg protein (LAL method)

The expression of full-length or partial-length protein depends on the specific research requirements. Custom production typically takes 5-9 weeks to complete .

What are the key considerations for designing experiments to study SLC25A26 function in Xenopus laevis spinal cord regeneration?

When designing experiments to study SLC25A26 function in Xenopus laevis spinal cord regeneration, researchers should consider the following key factors:

  • Developmental stage selection: Use regenerative stages (R-stages, NF 48-52) for regeneration studies and compare with post-metamorphic stages (NF 66) for non-regenerative controls .

  • Temporal dynamics: Design experiments that capture both early (1-day post-transection) and later time points, as transcriptomic analyses indicate that the highest number of differentially regulated transcripts occurs at 1-day post-transection .

  • Mitochondrial analysis techniques: Employ both electron and confocal microscopy to characterize temporal mitochondrial responses. Combining these approaches allows for comprehensive assessment of changes in mitochondrial number, distribution, morphology, and function .

  • Metabolic profiling: Include measurements of glycolytic metabolism and mitochondrial function, as spinal cord regeneration involves a transient metabolic shift toward glycolysis. Techniques should include analysis of mitochondrial membrane potential and enzyme activity of glycolytic genes .

  • Gene expression analysis: Monitor expression of SLC25A26 alongside other metabolic genes to understand the regulatory networks involved in the regenerative process .

What purification methods yield the highest recovery and purity for recombinant SLC25A26?

Based on standard protocols for similar mitochondrial carrier proteins, the following purification strategy is recommended for recombinant Xenopus laevis SLC25A26:

  • Affinity chromatography: Utilize nickel or cobalt affinity chromatography for His-tagged proteins as the initial purification step.

  • Size exclusion chromatography: Apply a secondary purification step using size exclusion chromatography to remove aggregates and improve homogeneity.

  • Buffer optimization: The protein shows highest stability in PBS buffer with potential additions of glycerol (10%) to enhance stability .

  • Quality control: Assess purity through SDS-PAGE (target >80% purity) and functional integrity through activity assays specific to SAM transport .

  • Endotoxin removal: For applications sensitive to endotoxin contamination, implement additional steps to ensure levels below 1.0 EU per μg of protein .

How does SLC25A26 expression change during Xenopus laevis spinal cord regeneration?

During Xenopus laevis spinal cord regeneration, mitochondrial carriers including SLC25A26 undergo significant changes in expression and function. Research has identified several key patterns:

  • Temporal expression dynamics: Transcriptomic analyses reveal substantial changes in metabolic gene expression, including mitochondrial carriers, with the most significant changes occurring at 1-day post-transection (dpt) .

  • Spatial redistribution: In uninjured animals, mitochondrial markers, including SLC25A26, are predominantly expressed in neural stem progenitor cells (NSPCs) surrounding the central canal. Following spinal cord injury (SCI), this apical distribution is disrupted, reflecting changing energy requirements during the regenerative process .

  • Functional adaptation: The expression changes coincide with a metabolic shift toward glycolysis, which appears to be necessary for successful regeneration. This shift is characterized by an early and transient decline in mitochondrial activity, reflected by decreased mitochondrial membrane potential .

  • Quantitative changes: Following SCI, there is a decrease in the number of mitochondria per cell section, accompanied by an increase in mitochondrial area and circularity. These morphological changes suggest adaptation to meet the changing metabolic demands during regeneration .

What is the relationship between SLC25A26 function and metabolic regulation during neural regeneration?

The relationship between SLC25A26 function and metabolic regulation during neural regeneration is multifaceted:

  • Metabolic shift mechanism: SLC25A26, as the primary mitochondrial S-adenosylmethionine carrier, plays a crucial role in methylation reactions within mitochondria. During regeneration, cells transiently shift toward glycolytic metabolism, which affects the methylation status of proteins involved in the regenerative process .

  • Temporal coordination: The transient decrease in mitochondrial function, likely involving altered SLC25A26 activity, precedes the peak of NSPC proliferation. This suggests that the metabolic shift may be a prerequisite for the proliferative response .

  • mTOR pathway interaction: The glycolytic activation during regeneration coincides with mTORC1 activation, which is necessary for NSPC proliferation. SLC25A26 may interact with this pathway through its effects on mitochondrial metabolism .

  • Cellular energy balance: Despite the morphological changes in mitochondria and the shift toward glycolysis, cellular energy balance is maintained during regeneration, indicating sophisticated regulatory mechanisms that likely involve SLC25A26-mediated processes .

How can CRISPR-Cas9 gene editing be optimized for studying SLC25A26 function in Xenopus laevis?

Optimizing CRISPR-Cas9 gene editing for studying SLC25A26 in Xenopus laevis requires careful consideration of several factors:

  • Guide RNA design: Target sequences with high specificity for SLC25A26 while minimizing off-target effects. Consider the following parameters for optimal gRNA selection:

ParameterRecommendation
gRNA length20 nucleotides
PAM sequenceNGG (standard for SpCas9)
GC content40-60%
Off-target predictionUse algorithms specific for Xenopus genome
Targeting strategyExon 1 or functional domains for knockout studies
  • Delivery methods: For Xenopus laevis, microinjection into fertilized eggs (one-cell stage) offers the most reliable method for delivering CRISPR components.

  • Mosaicism management: To address potential mosaicism, establish F0 founders and breed to obtain F1 generation with more consistent genetic modifications.

  • Functional rescue experiments: Design rescue experiments using wild-type SLC25A26 mRNA to confirm phenotype specificity.

  • Verification strategies: Implement a multi-level verification approach including:

    • Genomic PCR and sequencing

    • RT-qPCR for transcript level analysis

    • Western blotting for protein expression

    • Functional assays for S-adenosylmethionine transport

What insights from Xenopus laevis SLC25A26 research can be applied to understanding human neurodegenerative diseases?

Research on Xenopus laevis SLC25A26 offers valuable insights for human neurodegenerative diseases:

  • Mitochondrial dysfunction: SLC25A26 dysfunction in humans has been linked to mitochondrial diseases. The Xenopus model provides a platform to study how alterations in S-adenosylmethionine transport affect mitochondrial function in neural tissues, potentially informing research on neurodegenerative conditions associated with mitochondrial dysfunction .

  • Metabolic adaptation: The transient metabolic shift toward glycolysis observed during successful spinal cord regeneration in Xenopus suggests that manipulating metabolic pathways might have therapeutic potential for promoting neural repair in humans .

  • Cellular regenerative capacity: Understanding how SLC25A26 contributes to the remarkable regenerative capability of Xenopus larvae but is insufficient in post-metamorphic stages may provide insights into the limited regenerative capacity in adult humans .

  • Therapeutic target identification: Recent studies indicating abnormal SLC25A26 expression in certain cancers suggest it may serve as a potential therapeutic target. Similar approaches could be explored for neurodegenerative conditions .

How does SLC25A26 expression correlate with cancer development and progression?

Recent studies have revealed significant correlations between SLC25A26 expression and various cancers:

  • Differential expression: SLC25A26 shows abnormal expression patterns in multiple cancer types, including cervical cancer, low-grade glioma, non-small cell lung cancer, and liver cancer .

  • Mechanistic implications: As the only known human mitochondrial S-adenosylmethionine carrier encoding gene, SLC25A26 aberrant expression may affect methylation reactions within mitochondria, potentially altering cancer cell metabolism and contributing to cancer development and progression .

  • Prognostic potential: The aberrant expression patterns of SLC25A26 suggest its potential value as a prognostic marker for certain cancers .

  • Therapeutic targeting: The specific role of SLC25A26 in mitochondrial metabolism makes it a potential therapeutic target for some cancers, particularly those showing significant alterations in SLC25A26 expression .

What are the implications of SLC25A26 mutations for mitochondrial disease research?

SLC25A26 mutations have significant implications for mitochondrial disease research:

  • Disease etiology: Mutations in the SLC25A26 gene have been associated with specific mitochondrial diseases, highlighting its essential role in normal mitochondrial function .

  • Metabolic consequences: SLC25A26 mutations can disrupt S-adenosylmethionine transport into mitochondria, affecting methylation reactions essential for mitochondrial protein synthesis, RNA modification, and other crucial processes .

  • Xenopus as a disease model: The Xenopus laevis model offers opportunities to study the pathophysiological consequences of SLC25A26 mutations in a system with significant genetic and physiological similarities to humans .

  • Therapeutic development: Understanding the specific molecular pathways affected by SLC25A26 mutations could facilitate the development of targeted therapeutic approaches for mitochondrial diseases .

What are the main challenges in producing high-quality recombinant Xenopus laevis SLC25A26 protein?

Producing high-quality recombinant Xenopus laevis SLC25A26 protein presents several challenges:

  • Membrane protein solubility: As a mitochondrial carrier protein, SLC25A26 is a membrane protein that can be difficult to express in soluble form. Solutions include:

    • Optimization of detergent conditions during extraction and purification

    • Use of fusion partners to enhance solubility

    • Expression of selected functional domains rather than the full-length protein

  • Maintaining native conformation: Ensuring proper folding is critical for functional studies. Approaches include:

    • Expression in mammalian cells rather than bacterial systems

    • Careful optimization of buffer conditions

    • Addition of stabilizing agents during purification

  • Low expression yields: Mitochondrial carriers often express at lower levels than cytosolic proteins. Strategies to address this include:

    • Codon optimization for the expression host

    • Use of strong promoters specific to the expression system

    • Optimization of culture conditions and induction parameters

  • Functional validation: Confirming that the recombinant protein retains S-adenosylmethionine transport activity is essential. This requires:

    • Development of appropriate transport assays

    • Reconstitution into liposomes for functional studies

    • Comparison with native protein activity

How can researchers address inconsistent results in SLC25A26 functional studies?

Addressing inconsistent results in SLC25A26 functional studies requires systematic troubleshooting:

What are the most reliable methods for assessing SLC25A26 function in mitochondrial metabolism?

The most reliable methods for assessing SLC25A26 function in mitochondrial metabolism combine multiple complementary approaches:

  • Transport activity assays:

    • Reconstitution in liposomes with radiolabeled S-adenosylmethionine

    • Mitochondrial import assays using isolated mitochondria

    • Measurement of S-adenosylmethionine levels in mitochondrial fractions

  • Mitochondrial function assessment:

    • COX/SDH (cytochrome c oxidase/succinate dehydrogenase) staining to evaluate mitochondrial respiratory function

    • Measurement of mitochondrial membrane potential using fluorescent probes

    • Analysis of oxygen consumption rates in isolated mitochondria or intact cells

  • Morphological characterization:

    • Electron microscopy to analyze mitochondrial ultrastructure

    • Confocal microscopy with mitochondrial markers to assess distribution and dynamics

    • Quantitative analysis of mitochondrial number, area, and circularity

  • Metabolic profiling:

    • Analysis of glycolytic enzyme activity

    • Measurement of lactate production

    • Assessment of cellular ATP levels

    • Evaluation of methylation status of mitochondrial proteins

What emerging technologies might enhance our understanding of SLC25A26 function in Xenopus laevis?

Several emerging technologies hold promise for advancing our understanding of SLC25A26 function:

  • Single-cell transcriptomics and proteomics:

    • Mapping SLC25A26 expression at single-cell resolution during regeneration

    • Identifying cell type-specific roles in neural stem progenitor cells

    • Characterizing molecular signatures associated with regenerative capacity

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed mitochondrial structural analysis

    • Live-cell imaging to track mitochondrial dynamics during regeneration

    • Correlative light and electron microscopy (CLEM) for integrated structural and functional analysis

  • Metabolomics and fluxomics:

    • Comprehensive profiling of metabolic changes during regeneration

    • Stable isotope tracing to track S-adenosylmethionine metabolism

    • Integration of metabolomic data with transcriptomic and proteomic profiles

  • Organoid and ex vivo models:

    • Development of Xenopus spinal cord organoids for controlled functional studies

    • Ex vivo spinal cord slice cultures for high-throughput screening

    • Multi-organ-on-chip systems to study tissue interactions

What are the key unanswered questions regarding SLC25A26 in neural regeneration?

Despite significant advances, several key questions about SLC25A26 in neural regeneration remain unanswered:

  • Regulatory mechanisms: How is SLC25A26 expression and activity regulated during the regenerative process? What transcription factors and signaling pathways are involved?

  • Metabolic integration: How does SLC25A26-mediated S-adenosylmethionine transport coordinate with the observed glycolytic shift during regeneration? What are the methylation targets critical for successful regeneration?

  • Species-specific differences: Why do some species maintain regenerative capacity while others lose it? How do differences in SLC25A26 function contribute to this variation?

  • Therapeutic potential: Can modulation of SLC25A26 activity enhance regenerative capacity in non-regenerative models? What are the potential therapeutic applications for human spinal cord injury?

  • Developmental regulation: How does SLC25A26 function change during the transition from regenerative (larval) to non-regenerative (post-metamorphic) stages in Xenopus laevis?

How might interdisciplinary approaches advance SLC25A26 research?

Interdisciplinary approaches could significantly accelerate progress in SLC25A26 research:

  • Computational biology and systems biology:

    • Development of mathematical models of mitochondrial metabolism during regeneration

    • Network analysis to identify key regulatory nodes affecting SLC25A26 function

    • Predictive modeling of interventions to enhance regenerative capacity

  • Bioengineering and materials science:

    • Design of biomaterials that support mitochondrial function during regeneration

    • Development of controlled-release systems for metabolic modulators

    • Engineering of scaffolds that promote neural regeneration

  • Evolutionary biology:

    • Comparative analysis of SLC25A26 across species with different regenerative capacities

    • Identification of evolutionary adaptations in mitochondrial metabolism

    • Reconstruction of ancestral SLC25A26 proteins to understand functional evolution

  • Clinical research:

    • Translational studies examining SLC25A26 in human neurodegenerative conditions

    • Exploration of SLC25A26 as a biomarker for disease progression or treatment response

    • Development of therapeutics targeting SLC25A26 or related pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.