Recombinant Xenopus laevis Selenoprotein S B (sels-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
vimp-b; sels-b; Selenoprotein S B; SelS B; VCP-interacting membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
vimp-b
Target Protein Sequence
MELGNQPGQGNRPEIELEWYQYLQNTVGEALSNYGWYILLGCIVIYFLIQKLSANFTRAV ASTRTTVTDPDEIVRRQEAVAAARMRMQVELNAQAELYKQKQVQLQEEKRRRNIETWDRM QEGKSSKVGCRLVQDASPRTSTSSSAPKPKPESRPLRDSGYNPLTGGGGGTCAWRPGRRG PSSGGSUG
Uniprot No.

Target Background

Function

Selenoprotein S (SelS-b) is involved in the degradation pathway of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of these misfolded proteins from the ER to the cytosol, where they undergo ubiquitin-dependent proteasomal degradation.

Database Links

KEGG: xla:447390

UniGene: Xl.6021

Protein Families
Selenoprotein S family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is Selenoprotein S B and what is its significance in Xenopus laevis?

Selenoprotein S B (sels-b) is a member of the selenoprotein family in Xenopus laevis that contains the amino acid selenocysteine (Sec). Selenoproteins are characterized by the incorporation of selenium in the form of selenocysteine, which is encoded by UGA codons that normally function as stop codons. This recoding requires a specific RNA structure called the Sec insertion sequence (SECIS) found in the 3′ UTR of selenoprotein mRNAs .

In Xenopus laevis, selenoproteins play crucial roles in various biological processes, including antioxidant defense, redox regulation, and embryonic development. While specific functions of sels-b are still being elucidated, selenoproteins generally are essential for normal development and physiological functions in vertebrates, including amphibians like Xenopus laevis .

How does selenoprotein synthesis occur in Xenopus laevis?

Selenoprotein synthesis in Xenopus laevis involves a complex machinery that recognizes UGA codons as Sec-incorporating rather than termination signals. This process requires:

  • The SECIS element in the 3′ UTR of selenoprotein mRNAs

  • SECIS-binding protein 2 (Sbp2), which binds to the SECIS element

  • SECIS-binding protein 2-like (Secisbp2l), a paralogue of Sbp2 that can support selenoprotein synthesis when Sbp2 function is compromised

  • A specialized elongation factor (eEFSec) that delivers Sec-tRNA to the ribosome

Research has shown that Sbp2 is required for selenoprotein synthesis, while Secisbp2l can partially compensate for Sbp2 deficiency, suggesting a backup mechanism for maintaining essential selenoprotein expression .

What is the developmental expression pattern of selenoproteins in Xenopus laevis?

Selenoprotein expression in Xenopus laevis shows dynamic changes during embryonic development. Studies using 75Se-selenite labeling have demonstrated stage-specific patterns of selenoprotein synthesis:

  • During early embryogenesis (fertilized egg to neurula stage), approximately 4,000 proteins have been detected by mass spectrometry, including various selenoproteins

  • Expression of selenoproteins is not uniform across developmental stages, with some selenoproteins showing higher expression at specific stages

  • In zebrafish models (which share developmental pathways with Xenopus), loss of both Sbp2 and Secisbp2l leads to substantial reduction in selenoprotein synthesis, though early development can proceed with reduced selenoprotein levels

These patterns suggest that certain selenoproteins, including sels-b, may play stage-specific roles during embryonic development in Xenopus laevis.

How does the function of Selenoprotein S B differ from other selenoproteins in Xenopus laevis?

While the search results don't provide specific information about the unique functions of Selenoprotein S B in Xenopus laevis, comparative studies of selenoproteins suggest functional specialization:

  • Thioredoxin reductases (appearing as ~68-kD species in labeling experiments) are relatively resistant to depletion even when general selenoprotein synthesis is compromised, suggesting their essential nature

  • Different selenoproteins show varying sensitivity to disruption of the selenoprotein synthesis machinery, with some being more dependent on Sbp2 while others can utilize Secisbp2l

  • Selenoproteins exhibit tissue-specific expression patterns, with certain selenoproteins predominantly expressed in specific tissues or developmental stages

Selenoprotein S is generally involved in endoplasmic reticulum (ER) stress response and protein quality control in other vertebrates, suggesting that sels-b likely serves similar functions in Xenopus laevis, possibly with adaptations specific to amphibian physiology.

What are the molecular mechanisms underlying the regulation of sels-b expression?

The regulation of selenoprotein expression, including sels-b, involves multiple layers of control:

  • Transcriptional regulation: Like other selenoproteins, sels-b expression is likely regulated by tissue-specific transcription factors and developmental signals.

  • Post-transcriptional regulation: The efficiency of Sec incorporation depends on the SECIS element structure and its interaction with Sbp2 and Secisbp2l. Studies in zebrafish have shown that when selenoprotein synthesis is impaired due to disruption of Sbp2, there are changes in selenoprotein mRNA levels, indicating feedback mechanisms .

  • Selenium availability: The synthesis of selenoproteins is dependent on selenium availability, with hierarchical regulation ensuring that essential selenoproteins are preferentially synthesized under selenium-limiting conditions.

  • Oxidative stress response: Research has shown that larvae lacking Sbp2 (but not Secisbp2l) are more sensitive to peroxide stress, suggesting that selenoprotein expression, including potentially sels-b, is regulated in response to oxidative challenges .

How do epigenetic modifications influence selenoprotein S B expression in different developmental stages?

While the search results don't directly address epigenetic regulation of sels-b, we can draw insights from general principles of epigenetic regulation in Xenopus laevis:

  • Histone modifications play crucial roles in regulating gene expression during Xenopus development. Various post-translational modifications of histones, including methylation and acetylation, have been identified across different tissues and developmental stages .

  • These epigenetic marks likely contribute to the tissue-specific and developmental stage-specific expression patterns of selenoproteins, including sels-b.

  • The transition from maternal to zygotic gene expression, which occurs at the midblastula transition (MBT) in Xenopus, involves major epigenetic reprogramming that would affect selenoprotein gene regulation .

  • Future studies specifically examining histone modifications at the sels-b locus across developmental stages would provide direct evidence of epigenetic regulation of this selenoprotein.

What are the most effective methods for recombinant expression of Xenopus laevis selenoprotein S B?

Based on general principles of selenoprotein production and the limited information in the search results, the following methodological approach is recommended:

Expression System Selection:

  • Bacterial systems (e.g., E. coli) can be used but require co-expression of selenocysteine incorporation machinery

  • Eukaryotic systems (insect cells, mammalian cells) may provide better folding and post-translational modifications

  • Cell-free systems based on Xenopus egg extracts provide a native-like environment for selenoprotein synthesis

Key Considerations for Recombinant Expression:

  • Include the complete SECIS element from the 3' UTR in expression constructs

  • Co-express or supplement Sbp2 to enhance Sec incorporation efficiency

  • Supplement expression medium with sodium selenite (typically 100-200 nM)

  • Use optimized UGA context to improve Sec incorporation efficiency

  • Consider fusion tags that enhance solubility while minimizing interference with selenoprotein function

Purification Strategy:

  • Affinity chromatography using carefully positioned tags that don't interfere with selenoprotein function

  • Additional purification steps such as ion exchange or size exclusion chromatography

  • Verify selenocysteine incorporation using mass spectrometry

What experimental approaches are most suitable for studying the function of selenoprotein S B in Xenopus development?

Several complementary approaches can be employed to investigate sels-b function:

Genetic Manipulation:

  • CRISPR/Cas9-mediated gene editing to create sels-b knockout or knockdown models

  • Based on the zebrafish studies, consider targeting both sels-b and related factors (like Sbp2) to overcome potential functional redundancy

  • Inject mRNA encoding wild-type or mutant sels-b to assess rescue or dominant-negative effects

Expression Analysis:

  • 75Se labeling of embryos at different developmental stages to track selenoprotein synthesis

  • Quantitative proteomics using iTRAQ or similar approaches to measure protein abundance changes

  • Western blotting using specific antibodies against sels-b

  • In situ hybridization to determine spatial expression patterns

Functional Assays:

  • Stress response experiments, particularly involving oxidative stress (e.g., hydrogen peroxide treatment) and ER stress

  • Analysis of development under normal and stress conditions

  • Cellular localization studies using fluorescently tagged sels-b

How should researchers design experiments to investigate selenoprotein S B interactions with other cellular proteins?

To elucidate the interactome of selenoprotein S B in Xenopus laevis, consider the following experimental design:

Protein-Protein Interaction Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against sels-b to pull down interacting proteins, followed by mass spectrometry identification

  • Proximity labeling: BioID or APEX2 fusion with sels-b to identify proximal proteins in living cells

  • Yeast two-hybrid screening: Using sels-b as bait to screen Xenopus cDNA libraries

  • Cross-linking mass spectrometry: To capture transient interactions, particularly important for membrane-associated selenoproteins

Validation and Characterization:

  • Reciprocal Co-IP experiments

  • Co-localization studies using fluorescence microscopy

  • Functional validation through co-depletion experiments

  • Structure-function analysis using deletion mutants

Experimental Controls:

  • Include selenocysteine-to-cysteine mutants to assess the role of selenocysteine in protein interactions

  • Use selenoprotein synthesis-deficient backgrounds (e.g., Sbp2 knockdown) as controls

  • Compare interaction profiles across different developmental stages and tissues

How should researchers interpret changes in selenoprotein S B expression during developmental transitions?

When analyzing changes in sels-b expression during Xenopus development, consider the following interpretative framework:

Contextual Analysis:

  • Compare sels-b expression changes with other selenoproteins to identify general versus specific regulation patterns

  • Correlate expression changes with developmental transitions, particularly the midblastula transition (MBT) when maternal-to-zygotic transition occurs

  • Consider tissue-specific differentiation patterns that might explain localized expression changes

Quantitative Considerations:

  • Use appropriate normalization methods when comparing across developmental stages

  • Consider both absolute levels and relative changes in expression

  • Distinguish between changes in mRNA versus protein levels, as post-transcriptional regulation is significant for selenoproteins

Functional Interpretation:

  • Evaluate whether expression changes correlate with known developmental events requiring redox regulation or ER function

  • Consider compensatory mechanisms, as observed with Sbp2 and Secisbp2l in selenoprotein synthesis

  • Assess whether expression changes coincide with stress responses or major metabolic shifts

What are the common challenges in interpreting selenoprotein mass spectrometry data and how can they be addressed?

Mass spectrometry analysis of selenoproteins, including sels-b, presents several challenges:

Technical Challenges and Solutions:

ChallengeDescriptionSolution
Selenocysteine identificationSelenocysteine residues are often misidentified as cysteineUse specialized search algorithms that recognize selenocysteine; verify with isotopic pattern analysis
Low abundanceMany selenoproteins are expressed at low levelsEmploy enrichment strategies; use targeted approaches like SRM/MRM
Poor fragmentationSelenocysteine-containing peptides may show atypical fragmentation patternsOptimize collision energies; consider alternative fragmentation methods (ETD/ECD)
Quantification accuracyITRAq and similar methods may have limitations for selenoproteinsUse multiple quantification approaches; validate with orthogonal methods
Sample oxidationSelenium is susceptible to oxidation during sample preparationInclude reducing agents during sample preparation; process samples under inert gas

As demonstrated in the Xenopus proteomics study, iTRAQ labeling can be successfully applied to quantify development-specific protein expression, with careful sample preparation and data filtering to achieve protein-level false discovery rates <1% .

How can researchers distinguish between direct and indirect effects when manipulating selenoprotein S B expression?

Distinguishing direct from indirect effects is crucial when interpreting selenoprotein manipulation experiments:

Experimental Strategies:

  • Temporal resolution: Use inducible expression/depletion systems to capture immediate versus delayed effects

  • Rescue experiments: Test whether wild-type sels-b can rescue phenotypes, while functionally deficient mutants cannot

  • Domain-specific mutations: Create targeted mutations affecting specific biochemical functions of sels-b

  • Parallel pathway analysis: Monitor known downstream effectors and parallel pathways to identify compensatory responses

Control Considerations:

  • Include selenocysteine-to-cysteine mutants to isolate selenocysteine-dependent functions

  • Compare phenotypes with those resulting from general selenoprotein synthesis disruption (e.g., Sbp2 knockout)

  • Use graduated levels of knockdown/overexpression to establish dose-response relationships

  • Apply true experimental designs with appropriate controls to ensure internal validity

What are the common pitfalls in selenoprotein research using Xenopus models and how can they be avoided?

Research with selenoproteins in Xenopus models presents several challenges:

Common Pitfalls and Solutions:

PitfallSolution
Inefficient selenocysteine incorporationInclude the complete SECIS element in constructs; supplement media with sodium selenite; consider co-expression of Sbp2
Functional redundancy masking phenotypesTarget multiple related selenoproteins or factors simultaneously; use stress conditions to reveal latent phenotypes
Maternal contribution confounding early development studiesUse germline CRISPR approaches; start experiments at post-MBT stages; employ maternal protein depletion strategies
Inconsistent developmental stagingUse standardized staging criteria; include multiple developmental markers; document morphological features
Non-specific stress responsesInclude appropriate controls for manipulation methods; use multiple independent approaches to confirm findings

Technical Considerations:

  • For in vivo selenoprotein labeling, optimize 75Se-selenite concentration and exposure time to achieve sufficient signal without toxicity

  • When isolating histones or other nuclear proteins from Xenopus tissues, include sodium butyrate to preserve acetylation marks

  • For stored, predeposition histones from oocytes and eggs, purification by chromatography on heparin-Sepharose proves more effective than conventional acid extraction

What are the best practices for validating antibodies against Xenopus laevis selenoprotein S B?

Proper antibody validation is essential for reliable selenoprotein research:

Comprehensive Validation Strategy:

  • Specificity Testing:

    • Western blot analysis comparing wild-type and sels-b knockout/knockdown samples

    • Peptide competition assays to confirm epitope specificity

    • Cross-validation with orthogonal methods (e.g., mass spectrometry)

    • Testing across multiple Xenopus tissues to confirm consistent detection

  • Functional Validation:

    • Immunoprecipitation followed by activity assays

    • Immunodepletion studies to confirm antibody captures all target protein

    • Immunofluorescence correlation with expected subcellular localization

  • Cross-Reactivity Assessment:

    • Testing against related selenoproteins

    • Evaluation in heterologous expression systems

  • Documentation Requirements:

    • Catalog full experimental conditions (dilutions, incubation times, blocking agents)

    • Include positive and negative controls in published data

    • Provide validation data in supplementary materials

How can researchers accurately quantify selenoprotein S B expression across different developmental stages and tissues?

Accurate quantification of sels-b requires complementary approaches:

Recommended Quantification Methods:

  • Proteomics Approaches:

    • iTRAQ or TMT labeling for multiplexed quantitative comparison across samples, as demonstrated in Xenopus proteomics studies

    • Label-free quantification with appropriate normalization

    • Selected/Multiple Reaction Monitoring (SRM/MRM) for targeted quantification

    • Use single embryo analysis when possible to assess embryo-to-embryo variability

  • Western Blot Analysis:

    • Include recombinant protein standards for absolute quantification

    • Use multiple loading controls appropriate for the developmental stages being compared

    • Employ fluorescent secondary antibodies for wider linear range

    • Validate findings with biological replicates from independent batches of embryos

  • mRNA Quantification:

    • qRT-PCR with carefully validated reference genes

    • RNA-seq with appropriate normalization for developmental stage comparison

    • Consider nonsense-mediated decay effects on selenoprotein transcripts with premature termination

  • Metabolic Labeling:

    • 75Se incorporation provides direct visualization of newly synthesized selenoproteins

    • Pulse-chase experiments can reveal turnover rates

What are the emerging technologies that could advance selenoprotein S B research in Xenopus models?

Several cutting-edge technologies show promise for advancing sels-b research:

Emerging Technologies with Application to Selenoprotein Research:

  • CRISPR Screening and Engineering:

    • Genome-wide CRISPR screens to identify genetic interactors of sels-b

    • Base editing for precise modification of selenocysteine codons and regulatory elements

    • Prime editing for introducing specific mutations without double-strand breaks

    • Inducible CRISPR systems for temporal control of gene modification

  • Advanced Imaging:

    • Live imaging of fluorescently tagged sels-b to track dynamics during development

    • Super-resolution microscopy to resolve subcellular localization

    • Correlative light and electron microscopy (CLEM) to link function with ultrastructure

    • FRET sensors to monitor selenoprotein redox status in vivo

  • Single-Cell Technologies:

    • Single-cell proteomics to capture cell-type specific selenoprotein expression

    • Single-cell transcriptomics combined with spatial mapping

    • Nascent protein labeling to track selenoprotein synthesis at cellular resolution

  • Computational Approaches:

    • Machine learning for predicting selenoprotein interactions and functions

    • Systems biology modeling of selenoprotein networks during development

What are the key unanswered questions regarding selenoprotein S B function in Xenopus laevis development?

Several fundamental questions remain to be addressed:

  • Developmental Specificity: What are the specific developmental processes and transitions that require sels-b function? Is there a critical window during which sels-b is essential?

  • Compensation Mechanisms: How do other selenoproteins or related proteins compensate for sels-b deficiency? Does the relationship between Sbp2 and Secisbp2l observed in general selenoprotein synthesis specifically affect sels-b expression ?

  • Stress Response Role: Given the sensitivity of Sbp2-deficient larvae to oxidative stress , what is the specific contribution of sels-b to stress resistance during development?

  • Evolutionary Conservation: How conserved is sels-b function between Xenopus and other vertebrates? Are there amphibian-specific adaptations in its function?

  • Regulation Network: What transcription factors and signaling pathways regulate sels-b expression during development? How does this regulation differ from other selenoproteins?

  • Tissue-Specific Functions: Does sels-b serve different functions in different tissues during Xenopus development, and how do these functions relate to tissue-specific stressors?

How might integrating selenoprotein S B research with broader developmental biology questions advance the field?

Integrating sels-b research with broader developmental biology could yield significant insights:

Integration Opportunities:

  • Redox Biology of Development: Investigating how sels-b contributes to the redox regulation necessary for proper signaling during embryogenesis

  • Stress Adaptation: Exploring how selenoproteins, including sels-b, enable embryos to adapt to environmental stressors, building on observations that selenoprotein deficiency increases sensitivity to oxidative stress

  • Maternal-to-Zygotic Transition: Examining the role of sels-b during the critical maternal-to-zygotic transition (MBT), when many maternal proteins decline and zygotic gene expression increases

  • Comparative Development: Using sels-b as a model to understand how selenoprotein functions are conserved or divergent across vertebrate development

  • Cellular Differentiation: Investigating whether sels-b plays specific roles in the differentiation of particular cell lineages during development

  • Metabolic Regulation: Exploring the intersection between selenoprotein function and metabolic regulation during the energy-demanding process of embryogenesis

By addressing these integrated questions, researchers can place selenoprotein S B within the broader context of developmental biology, potentially revealing new principles of both selenoprotein biology and developmental regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.