Recombinant Xenopus laevis Short-chain dehydrogenase/reductase family 42E member 1 (sdr42e1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus laevis Short-chain Dehydrogenase/Reductase Family 42E Member 1 (SDR42E1)

Recombinant Xenopus laevis Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1) refers to a specific enzyme within the short-chain dehydrogenase/reductase (SDR) superfamily, found in the Xenopus laevis species of frog . SDR42E1 is involved in multiple physiological processes . Xenopus laevis has been utilized as a vertebrate model for the study of embryonic development for decades .

Characteristics of SDR42E1

SDR42E1 belongs to the short-chain dehydrogenase/reductase (SDR) superfamily . SDRs are a large family of enzymes that utilize NAD(P)(H) as cofactors . SDR enzymes typically consist of approximately 250 amino acid residues . SDR42E1 is found in multiple organisms, including humans, mice, rats, cows, sheep, dogs, zebrafish, domestic cats, and naked mole rats .

Function and Activity

SDR42E1 is predicted to have oxidoreductase activity, acting on the CH-OH group of donors, and using NAD or NADP as an acceptor . It is also predicted to participate in the steroid biosynthetic process and to be an integral component of the membrane . Studies indicate that mutations in the SDR42E1 gene can alter steroid hormone synthesis and are associated with certain syndromes .

Genetic Information

SDR42E1 is encoded by the SDR42E1 gene . The human SDR42E1 gene is located at HGNC: 29834, NCBI Gene: 93517, Ensembl: ENSG00000184860, OMIM®: 616164, and UniProtKB/Swiss-Prot: Q8WUS8 .

Clinical Significance

Research indicates that mutations in SDR42E1 are related to certain diseases. For example, a homozygous missense mutation in SDR42E1 was identified in a family with affected siblings displaying brittle cornea syndrome, hyperelasticity of the skin, joint hypermobility, muscle weakness, hearing loss, and dental abnormalities, as well as micropenis, hypospadias, and cryptorchidism, suggesting abnormalities in endocrine pathways . This oculocutaneous genital syndrome highlights the role of SDR42E1 in cholesterol metabolism, the maintenance of connective tissue, and sexual maturation .

SDR42E1 in Different Species

SDR42E1 has orthologs in various species :

  • Human (Homo sapiens): Gene ID 93517

  • Mouse (Mus musculus): Gene ID 74032

  • Rat (Rattus norvegicus): Gene ID 307897

  • Cow (Bos taurus): Gene ID 532489

  • Sheep (Ovis aries): Gene ID 101122542

  • Domestic guinea pig (Cavia porcellus): Gene ID 100730396

  • Dog (Canis lupus familiaris): Gene ID 489691

  • Zebrafish (Danio rerio): Gene ID 565964

  • Domestic cat (Felis catus): Gene ID 101081181

  • Naked mole-rat (Heterocephalus glaber): Gene ID 101720255

  • Chicken (Gallus gallus): Gene ID 415806

Research Tools

Several tools are available for studying SDR42E1 :

  • siRNA: Predesigned siRNA for gene silencing.

  • shRNA: Validated shRNA collections for knockdown studies.

  • Custom Gene Products: Custom DNA oligos, RNA oligos, and predesigned primers.

  • Antibodies: Anti-SDR42E1 antibodies for protein detection (e.g., HPA014388).

  • esiRNA: MISSION® esiRNA for targeting mouse (Sdr42e1) and human (SDR42E1).

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipping; additional fees apply.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion in the manufacturing process.

Synonyms
sdr42e1; Short-chain dehydrogenase/reductase family 42E member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
sdr42e1
Target Protein Sequence
MSSSQRAKETVVITGGGGYFGHRLGCTLHEKGVHVILFDIRKPDQELPEGIHFVQGDVRS LSQLEDVVAGASCVFHTASYGMSGKEQLHRQKIEAINVRGTENIIQACINTNVPRLVYTS TFNVIFGGQTIRDGDESLPYLPQDAFVDNYSRTKTVAEMFVLKMNNQELKNNSGFLRTCS LRAAGIYGPGEQRHLPRIISALEKGMFLFVYGDNPLVQFVHVDNLISAHILAAEALTSEK KYIAAGQPYFISDGPPVNNFEFFRPLVEGLGYKFPSLRFPLSLVYFFAFLTEWIHFFISP VCDFQPILTRAEVFKTGVTHYFKIEKATRELGFEPQPFTMQDVAEWFKNHGYGKQDKKIK SNYLIWDIIFILLVTVVLLSWLPSSE
Uniprot No.

Target Background

Database Links

KEGG: xla:779408

UniGene: Xl.32536

Protein Families
3-beta-HSD family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should SDR42E1 be stored to maintain optimal activity?

For maximal stability and activity retention, store recombinant SDR42E1 protein in Tris-based buffer with 50% glycerol at -20°C for routine use and -80°C for long-term storage. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they significantly reduce enzymatic activity . Activity assessments before experimental use are recommended using spectrophotometric assays measuring cofactor (NAD(P)H) oxidation/reduction at 340 nm. Researchers should validate protein integrity via SDS-PAGE prior to functional experiments.

What is the established role of SDR42E1 in steroid biosynthesis?

SDR42E1 functions as an oxidoreductase in steroid hormone biosynthetic pathways, particularly affecting cholesterol metabolism. Research indicates that SDR42E1 mutations lead to decreased cholesterol levels in patients, supporting its role in steroid biosynthesis .

Methodologically, researchers studying this function should employ:

  • Metabolic profiling: Liquid chromatography-mass spectrometry (LC-MS) analysis of steroid metabolites in SDR42E1 knockdown/knockout models compared to controls

  • Enzyme kinetic assays: Using purified recombinant protein with various steroid substrates and NAD(P)/NAD(P)H cofactors

  • In vitro reconstitution assays: Combining SDR42E1 with other steroidogenic enzymes to reconstruct the pathway

The enzyme likely acts on the CH-OH group of steroid intermediates, utilizing NAD or NADP as an electron acceptor . Recent studies also indicate it participates in vitamin D biosynthesis pathways, suggesting a multifunctional role in steroid metabolism .

How does SDR42E1 contribute to vitamin D homeostasis?

Recent multi-omics investigations reveal SDR42E1's pivotal involvement in vitamin D biosynthesis pathways . The exact mechanistic step catalyzed by SDR42E1 appears to be in the conversion of vitamin D precursors.

To investigate this function, researchers should:

  • Employ CRISPR/Cas9 knockout models: Generate SDR42E1-deficient cell lines (particularly in keratinocytes where expression is high)

  • Conduct metabolomic profiling: Measure vitamin D metabolites (25-hydroxyvitamin D, 1,25-dihydroxyvitamin D) in control versus knockout models

  • Perform enzyme assays: Test recombinant SDR42E1 activity with vitamin D precursors

  • Apply UV irradiation experiments: Compare vitamin D synthesis in normal versus SDR42E1-deficient skin models

The rs11542462 nonsense variant in the human SDR42E1 gene significantly impacts vitamin D homeostasis, providing a genetic tool for further mechanistic studies .

What expression systems are optimal for producing functional recombinant Xenopus laevis SDR42E1?

For optimal expression of functional Xenopus laevis SDR42E1, consider these methodological approaches:

Expression SystemAdvantagesLimitationsRecommended Protocol
E. coli (BL21(DE3))High yield, cost-effectivePotential misfolding, lack of post-translational modificationsIPTG induction at 18°C for 16h; purification via His-tag affinity chromatography
Baculovirus/Insect cellsBetter folding, some PTMsModerate yield, more complexInfection at MOI 2-5, harvest 72h post-infection; purification via affinity and gel filtration
Mammalian cells (HEK293)Natural folding, complete PTMsLower yield, expensiveTransient transfection with PEI, harvest after 72h; immunoaffinity purification
Xenopus oocytesNative environment for frog proteinLabor-intensive, lower yieldmRNA microinjection; protein extraction with specific detergents

For structural or enzymatic studies, E. coli or baculovirus systems typically provide sufficient quantities of active protein. For interaction studies investigating native complexes or PTM-dependent activities, mammalian expression is recommended. Always verify enzymatic activity using NAD(P)H-linked spectrophotometric assays before downstream applications .

How can CRISPR/Cas9 genome editing be optimized for studying SDR42E1 function in Xenopus?

Effective CRISPR/Cas9 genome editing for studying SDR42E1 function in Xenopus should follow these methodological considerations:

  • gRNA design: Target conserved functional domains including the NAD(P)-binding region and catalytic residues. Design at least 3-4 gRNAs with minimal off-target effects using tools like CRISPRscan specifically optimized for Xenopus.

  • Delivery method: For rapid analysis, inject Cas9 protein (1-2 ng) and gRNA (400-500 pg) into fertilized eggs at the one-cell stage. For tissue-specific knockout, employ the Tol2 transposon system with tissue-specific promoters.

  • Validation strategy:

    • T7E1 assay or direct sequencing to confirm indel formation (F0)

    • RT-PCR and Western blotting to verify reduced expression

    • Phenotypic analysis focused on developmental defects related to steroid deficiency

  • Controls: Include both Cas9-only injections and non-targeting gRNA controls to distinguish specific phenotypes from injection artifacts.

This approach is particularly effective in Xenopus tropicalis rather than X. laevis due to the latter's allotetraploid genome which complicates complete gene knockout . For X. laevis, target both homeologs (L and S) simultaneously or employ dominant negative constructs as complementary approaches.

What developmental phenotypes are associated with SDR42E1 dysfunction?

SDR42E1 dysfunction is associated with a constellation of developmental abnormalities now classified as "oculocutaneous genital syndrome" . The homozygous missense mutation c.461G > A (p.Arg154Gln) produces the following phenotypic manifestations:

Organ SystemPhenotypic ManifestationsPotential Mechanism
OcularCorneal thinning, blue sclera, keratoconusConnective tissue disruption due to altered steroid signaling
CutaneousSkin hyperelasticityCollagen/elastin abnormalities from steroid imbalance
MusculoskeletalJoint hypermobility, muscle weaknessAltered connective tissue integrity
AuditoryHearing lossStructural abnormalities in inner ear
DentalVarious dental abnormalitiesDevelopmental disruption of tooth formation
UrogenitalMicropenis, hypospadias, cryptorchidismCompromised androgen synthesis/signaling
MetabolicDecreased cholesterol levelsDirect enzymatic role in cholesterol metabolism

To study these phenotypes, researchers should:

  • Generate tissue-specific knockout models focusing on affected systems

  • Perform comparative histological analysis between wild-type and mutant tissues

  • Conduct metabolomic profiling with emphasis on steroid pathway intermediates

  • Investigate transcriptional changes in collagen and extracellular matrix genes

The pleiotropic effects suggest SDR42E1's crucial role in multiple developmental pathways, particularly those requiring proper steroid hormone signaling .

How can contradictory data on SDR42E1 phenotypes between species be reconciled?

Resolving contradictory phenotypic data between species requires systematic comparative analysis:

  • Evolutionary context analysis: Construct phylogenetic trees of SDR42E1 across species to identify divergent domains that might explain functional differences. Compare enzymatic properties of SDR42E1 orthologs from various species using recombinant proteins.

  • Expression pattern mapping: Generate comprehensive expression atlases across developmental stages and tissues in different model organisms using RNA-seq and in situ hybridization to identify species-specific expression patterns.

  • Functional complementation experiments: Test if human SDR42E1 can rescue phenotypes in Xenopus SDR42E1 knockouts and vice versa. Cross-species complementation results will indicate whether discrepancies stem from protein function or contextual differences.

  • Interactome analysis: Compare SDR42E1 protein-protein interaction networks between species using BioID or affinity purification-mass spectrometry to identify divergent binding partners.

  • Pathway conservation assessment: Compare the steroid biosynthesis and vitamin D metabolism pathways between species to identify compensatory mechanisms or parallel pathways that might mask phenotypes in certain species.

This integrated approach helps distinguish conserved core functions from species-specific adaptations, resolving apparent contradictions in experimental data .

What protein interaction networks involve SDR42E1 in steroid hormone synthesis?

SDR42E1 likely operates within a complex protein interaction network in steroid biosynthesis pathways. To elucidate these networks, employ these advanced methodological approaches:

  • Proximity labeling proteomics: Implement BioID or APEX2 tagging of SDR42E1 in relevant cell types (adrenal, gonadal, or skin cells) to identify proximal interacting proteins within the cellular microenvironment.

  • Co-immunoprecipitation coupled with mass spectrometry: Use anti-SDR42E1 antibodies for pulldown experiments followed by unbiased proteomic identification of binding partners.

  • Yeast two-hybrid screening: Employ SDR42E1 as bait against tissue-specific cDNA libraries to identify direct protein-protein interactions.

  • Membrane yeast two-hybrid (MYTH): Since SDR42E1 is predicted to be membrane-associated , this specialized Y2H system is particularly relevant.

  • Computational network analysis: Integrate experimental data with predicted interactions based on co-expression patterns and pathway databases.

Expected interaction partners include:

  • Other steroidogenic enzymes (CYP11A1, CYP17A1, HSD3B)

  • Cholesterol transport proteins (StAR, NPC1, NPC2)

  • Vitamin D metabolism enzymes (CYP2R1, CYP27B1)

  • Electron transfer proteins (ferredoxin, adrenodoxin reductase)

These methodologies will reveal the functional protein complexes through which SDR42E1 exerts its effects on steroid and vitamin D homeostasis .

How do post-translational modifications regulate SDR42E1 activity?

Post-translational modifications (PTMs) likely play critical roles in regulating SDR42E1 activity. To investigate this complex regulatory layer, implement these methodological approaches:

  • PTM site mapping: Perform high-resolution mass spectrometry analysis of purified endogenous or recombinant SDR42E1 to identify phosphorylation, glycosylation, acetylation, or ubiquitination sites. Compare PTM profiles from different tissues and under various physiological conditions.

  • Site-directed mutagenesis: Generate SDR42E1 variants with mutated PTM sites (e.g., phosphomimetic S→D or phospho-deficient S→A mutations) and assess their effect on:

    • Enzymatic activity in vitro

    • Protein stability and half-life

    • Subcellular localization

    • Interaction with binding partners

  • Dynamic PTM profiling: Monitor changes in SDR42E1 PTMs in response to relevant stimuli (hormone treatment, metabolic stress) using quantitative proteomics with stable isotope labeling.

  • PTM-specific functional assays: Develop assays to directly correlate specific PTMs with enzymatic activity, such as:

    • In vitro activity assays with enzymatically modified SDR42E1

    • Cellular assays comparing wild-type versus PTM-deficient mutants

  • PTM enzyme identification: Use chemical inhibitors or genetic approaches to identify the kinases, phosphatases, or other enzymes responsible for adding or removing specific PTMs on SDR42E1.

These approaches will uncover how regulatory mechanisms like phosphorylation cascades or ubiquitin-mediated turnover modulate SDR42E1's role in steroid and vitamin D metabolism, potentially revealing therapeutic targets for associated disorders .

What structural determinants influence substrate specificity in the SDR42E1 enzyme?

Understanding the structural basis of SDR42E1 substrate specificity requires an integrated structural biology approach:

  • Structural determination: Solve the three-dimensional structure of SDR42E1 through X-ray crystallography or cryo-EM, ideally in complex with various substrates and cofactors. For challenging membrane proteins like SDR42E1, consider:

    • Detergent screening for optimal solubilization

    • Lipidic cubic phase crystallization

    • Nanobody-assisted structural biology

  • Molecular dynamics simulations: Perform extensive simulations to:

    • Map substrate binding channels

    • Identify dynamic conformational changes during catalysis

    • Calculate binding energies for different steroid substrates

  • Structure-guided mutagenesis: Based on structural data, design mutations targeting:

    • Residues in the substrate binding pocket

    • Catalytic tetrad (N-S-Y-K) components

    • Residues involved in cofactor preference (NAD vs. NADP)

    Assess the impact of these mutations on substrate preference and catalytic efficiency.

  • Comparative structural analysis: Analyze structures of related SDR family members with known substrate preferences to identify conserved and divergent features that determine specificity.

  • Biophysical binding assays: Employ isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) to quantify binding affinities for various substrates.

This integrated approach will elucidate how specific amino acids and structural domains determine SDR42E1's preference for certain steroid substrates or vitamin D metabolites, providing insights for rational enzyme engineering and drug design targeting SDR42E1-associated pathways .

How can multi-omics approaches be leveraged to fully characterize SDR42E1 function?

Multi-omics integration offers a comprehensive approach to characterizing SDR42E1 function across biological contexts. Implement the following methodological framework:

  • Integrative genomics, transcriptomics, proteomics and metabolomics:

    • Genomics: Identify regulatory regions and genetic variants affecting SDR42E1 expression

    • Transcriptomics: Map expression patterns across tissues and developmental stages

    • Proteomics: Quantify protein abundance, PTMs, and interaction networks

    • Metabolomics: Measure changes in steroid and vitamin D metabolites

  • Multi-layered data integration strategy:

    • Use network-based approaches to correlate SDR42E1 expression with global metabolic changes

    • Apply machine learning algorithms to identify predictive biomarkers of SDR42E1 activity

    • Employ causal network inference to distinguish direct from indirect effects

  • Temporal profiling: Conduct time-course experiments following SDR42E1 perturbation to capture cascade effects across biological scales.

  • Single-cell multi-omics: Apply single-cell RNA-seq and proteomics to identify cell populations particularly dependent on SDR42E1 function.

  • In vivo validation: Test hypotheses generated from multi-omics data using targeted in vivo experiments in Xenopus and mammalian models.

This comprehensive approach has already revealed SDR42E1's unexpected role in vitamin D metabolism and will likely uncover additional functions in previously unrecognized pathways .

What is the evolutionary significance of SDR42E1 conservation across vertebrate species?

The evolutionary conservation of SDR42E1 across vertebrates suggests fundamental biological importance. To investigate its evolutionary significance, employ these methodological approaches:

  • Comprehensive phylogenetic analysis:

    • Construct maximum likelihood phylogenetic trees using SDR42E1 sequences from diverse vertebrate lineages

    • Calculate selection pressures (dN/dS ratios) to identify conserved functional domains

    • Map sequence divergence to structural features to correlate with potential functional shifts

  • Ancestral sequence reconstruction:

    • Infer ancestral SDR42E1 sequences at key evolutionary nodes

    • Express and characterize ancestral enzymes to track functional evolution

    • Compare substrate preferences of ancestral versus modern SDR42E1 variants

  • Comparative expression analysis:

    • Compare tissue-specific expression patterns across species using transcriptomic data

    • Identify conserved versus species-specific regulatory elements

    • Correlate expression patterns with physiological adaptations

  • Functional complementation tests:

    • Test cross-species rescue experiments in model systems

    • Identify species-specific versus universally conserved functions

  • Correlation with metabolic evolution:

    • Map SDR42E1 evolutionary changes against the evolution of steroid signaling pathways

    • Investigate co-evolution patterns with interacting proteins

This evolutionary perspective will provide insights into how SDR42E1's role in steroid metabolism and vitamin D homeostasis has been shaped by vertebrate adaptation to diverse environments and physiological demands .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.