Recombinant Xenopus laevis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (nkain3)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Xenopus laevis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 (nkain3) is a synthetic, His-tagged protein engineered to study the interaction between NKAIN3 and the beta subunit of the Na⁺/K⁺-ATPase. This protein is derived from the African clawed frog (Xenopus laevis) and is produced in Escherichia coli for structural, functional, and biochemical studies .

Protein Features

ParameterDetails
SourceE. coli
TagN-terminal His tag
LengthFull-length (1–179 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C; avoid freeze-thaw cycles
ReconstitutionSterile water (0.1–1.0 mg/mL); 5–50% glycerol recommended
BufferTris/PBS-based with 6% trehalose, pH 8.0

Expression System

nkain3 is expressed in E. coli due to its compatibility with bacterial systems and cost-effectiveness. The His tag facilitates affinity purification using nickel or cobalt columns .

Quality Control

  • Purity Validation: SDS-PAGE confirms >90% purity .

  • Stability: Lyophilization ensures long-term storage stability. Trehalose in the buffer prevents aggregation during reconstitution .

Functional Studies

NKAIN3 binds the beta subunit of Na⁺/K⁺-ATPase, potentially modulating its activity. In Drosophila, reduced dNKAIN (the homolog) causes hyperexcitability, suggesting a role in stabilizing neuronal membranes . Mammalian NKAIN3 may regulate Na⁺/K⁺-ATPase localization or function in the central nervous system .

Neurological Relevance

  • Neuronal Excitability: NKAIN3 may suppress inappropriate depolarization, linking it to epilepsy or seizure disorders .

  • Myelination: Interactions with oligodendrocyte proteins (e.g., TENM4) hint at roles in axonal myelination .

Comparative Analysis of NKAIN3 and Na⁺/K⁺-ATPase

FeatureNKAIN3Na⁺/K⁺-ATPase (Beta Subunit)
FunctionRegulatory interactionIon transport (Na⁺/K⁺ exchange)
LocalizationMembrane-boundPlasma membrane
Key InteractionBeta subunit C-terminal tailAlpha subunit (catalytic domain)

Tissue Expression (Human NKAIN3 Paralogs)

TissueExpressionSource
BrainHigh (neurons)
TestisModerate
CNS AxonsAssociated with myelination

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference point for your own protocols.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms, on the other hand, have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its implementation.
Synonyms
nkain3; Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3; Na(+/K(+-transporting ATPase subunit beta-1-interacting protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
nkain3
Target Protein Sequence
MGCCTGRCTLVFICTLQMLVALERQIFDFLGYQWAPILGNFLHIIVVILGLFGTIQYRPR YIVAYTIWTAFWVAWNVFIICFYLEVGGLSKDTDLMTFNISIHRSWWREHGPGCVWRLVP APPSKNLGDHSFISVTGCIIEYQYLEVIHSAVQILLSLIGFVYACYVISVITDEEDSST
Uniprot No.

Target Background

Database Links

KEGG: xla:447099

UniGene: Xl.48989

Protein Families
NKAIN family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of NKAIN3 in Xenopus laevis?

NKAIN3 (Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3) belongs to the Na+/K+-ATPase interacting family of proteins. In Xenopus laevis, this protein is involved in ion transport regulation, particularly through its interaction with Na+/K+-ATPase. The protein contains transmembrane domains characteristic of ion channel-associated proteins and regulatory domains that mediate protein-protein interactions.

NKAIN3 remains largely understudied, with limited publications (PubMed score of 1.08) and minimal gene reference information fragments (only 1 Gene RIF) . Structurally, comparative analysis with other species suggests the protein likely contains conserved domains for membrane insertion and Na+/K+-ATPase binding.

For initial characterization, researchers should consider:

  • Sequence alignment with mammalian NKAIN3 to identify conserved domains

  • Hydropathy plot analysis to confirm predicted transmembrane regions

  • Co-immunoprecipitation with Na+/K+-ATPase to verify interaction in Xenopus laevis

What expression patterns does NKAIN3 show during Xenopus development?

NKAIN3 expression during Xenopus laevis development follows tissue-specific patterns, with notable expression in neural tissues and organs involved in osmoregulation. While specific developmental expression data for NKAIN3 in Xenopus is limited, researchers can investigate expression patterns through:

  • Whole-mount in situ hybridization at different developmental stages (from blastula to tadpole)

  • RT-qPCR analysis of tissue samples across developmental time points

  • Immunohistochemistry using available antibodies (7 antibodies have been reported)

When designing developmental studies, consider that NKAIN3 expression may be regulated by environmental factors affecting osmotic balance, similar to other ion transport regulators in Xenopus that respond to dehydration conditions .

What are the optimal expression systems for producing recombinant Xenopus laevis NKAIN3?

The selection of an appropriate expression system for recombinant Xenopus laevis NKAIN3 depends on experimental goals:

Bacterial expression (E. coli):

  • Advantages: High yield, cost-effective, rapid production

  • Limitations: Membrane proteins often misfold; limited post-translational modifications

  • Recommended strains: BL21(DE3) for general expression; Rosetta for rare codon optimization

Yeast expression (P. pastoris):

  • Advantages: Eukaryotic protein processing; good for membrane proteins

  • Limitations: Longer production time; different glycosylation patterns

Baculovirus expression:

  • Advantages: Near-native post-translational modifications; suitable for complex proteins

  • Limitations: More costly; technically demanding

Xenopus oocyte expression:

  • Advantages: Native cellular environment; functional testing capability

  • Limitations: Lower yield; not suitable for large-scale production

When using immobilized metal affinity chromatography (IMAC) for purification, researchers should be aware of potential co-purification of native E. coli proteins, which can contaminate recombinant protein preparations . Implementing a two-step purification process with size exclusion chromatography as a second step is recommended.

How can I optimize solubility and stability of recombinant NKAIN3?

Membrane proteins like NKAIN3 present significant challenges for solubility and stability. Optimized approaches include:

Solubilization strategies:

  • Detergent screening: Test a panel of detergents including DDM, LMNG, and CHAPS at varying concentrations

  • Lipid nanodisc incorporation: Reconstitute purified protein into synthetic lipid bilayers

  • Fusion protein approaches: N-terminal fusion with MBP or SUMO can enhance solubility

Stability enhancement:

  • Buffer optimization: Screen buffers with varying pH (6.5-8.0) and salt concentrations (100-500 mM)

  • Addition of glycerol (5-10%) and specific lipids (cholesterol, PE, PC) to mimic native membrane environment

  • Storage at -80°C in single-use aliquots with 10% glycerol to prevent freeze-thaw degradation

DetergentConcentration RangeAdvantagesLimitations
DDM0.03-0.1%Good for initial extractionMay destabilize over time
LMNG0.01-0.05%Enhanced stabilityMore expensive
CHAPS0.5-1.0%Compatible with functional assaysLess efficient extraction
Digitonin0.1-0.5%Preserves protein-protein interactionsNatural product variability

Incorporation of phospholipids (0.01-0.05 mg/ml) can significantly enhance stability of the purified protein.

What methods are effective for studying NKAIN3 interactions with Na+/K+-ATPase in Xenopus systems?

Several complementary approaches can be employed to investigate NKAIN3 interactions with Na+/K+-ATPase in Xenopus systems:

In vitro interaction assays:

  • Pull-down assays using recombinant tagged NKAIN3 and Xenopus Na+/K+-ATPase

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

Cellular interaction studies:

  • Xenopus oocyte expression with co-immunoprecipitation

  • Bimolecular Fluorescence Complementation (BiFC) in cultured Xenopus cells

  • Proximity ligation assay (PLA) in tissue sections

Functional impact assessment:

  • Electrophysiological measurements in Xenopus oocytes expressing both proteins

  • Rubidium flux assays to measure Na+/K+-ATPase activity with/without NKAIN3

  • ATPase activity assays using purified proteins in reconstituted systems

Drawing from methodologies used in studying other regulatory proteins in Xenopus, like PbRpt3's interaction with protein phosphatase 1, researchers can adapt experimental designs by expressing NKAIN3 cRNA in Xenopus oocytes to study its functional effects . This system has been successfully used to characterize protein-protein interactions and their functional consequences in Xenopus.

How can phosphorylation status of NKAIN3 be analyzed in Xenopus tissues?

Phosphorylation is a key post-translational modification that may regulate NKAIN3 function. Several approaches can be employed for comprehensive phosphorylation analysis:

Mass spectrometry-based approaches:

  • Phosphopeptide enrichment using TiO2 or immobilized metal affinity chromatography (IMAC)

  • LC-MS/MS analysis of enriched phosphopeptides

  • Quantitative phosphoproteomics using SILAC or TMT labeling

Site-specific phosphorylation analysis:

  • Generation of phospho-specific antibodies against predicted sites

  • Phosphatase treatment assays to confirm phosphorylation

  • Site-directed mutagenesis of putative phosphorylation sites

Functional impact assessment:

  • In vitro kinase assays to identify responsible kinases

  • Phosphomimetic mutations (S/T→D/E) to study functional effects

  • Comparative analysis of phosphorylation patterns under different physiological conditions

Previous phosphoproteomic studies in Xenopus laevis have revealed regulation of metabolism and cellular responses to environmental stressors through protein phosphorylation . Similar approaches can be applied to study NKAIN3 phosphorylation in response to osmotic or other physiological challenges.

What is the role of NKAIN3 in Xenopus laevis adaptation to dehydration?

Xenopus laevis naturally experiences dehydration during dry seasons and has evolved physiological adaptations to survive these conditions. The potential role of NKAIN3 in this process can be investigated through:

Expression analysis during dehydration:

  • RT-qPCR analysis of NKAIN3 transcript levels in tissues from control and dehydrated frogs

  • Western blot analysis of protein expression changes

  • Immunohistochemistry to detect changes in subcellular localization

Functional studies:

  • Correlation of NKAIN3 expression/phosphorylation with Na+/K+-ATPase activity

  • Measurements of ion transport in isolated tissues with manipulated NKAIN3 levels

  • Analysis of NKAIN3 knockout/knockdown effects on dehydration tolerance

Previous studies have shown that Xenopus laevis responds to dehydration through regulation of proteins involved in metabolism, including glycolysis/gluconeogenesis and TCA cycle components . Similarly, NKAIN3 might contribute to osmotic balance regulation during dehydration by modulating Na+/K+-ATPase activity in key tissues like skin, bladder, and kidney.

A comprehensive experimental approach would include measuring NKAIN3 expression and phosphorylation status alongside physiological parameters like plasma ion concentrations, tissue water content, and Na+/K+-ATPase activity across a dehydration time course.

How does NKAIN3 function compare between Xenopus laevis and mammalian models?

Comparative analysis between Xenopus and mammalian NKAIN3 provides insights into evolutionary conservation and specialization:

Sequence and structural comparison:

  • Multiple sequence alignment to identify conserved domains and species-specific regions

  • Homology modeling based on available structural data

  • Analysis of conservation at functional interfaces with Na+/K+-ATPase

Functional comparison:

  • Heterologous expression studies in mammalian cell lines vs. Xenopus oocytes

  • Cross-species complementation experiments

  • Comparison of tissue expression patterns and developmental profiles

Regulatory mechanism differences:

  • Analysis of transcriptional regulation and promoter elements

  • Comparison of post-translational modifications

  • Evaluation of protein-protein interaction networks

Current knowledge of NKAIN3 remains limited across species, with a PubMed knowledge score of only 0.91 . This presents an opportunity for researchers to establish fundamental comparative biology for this protein family.

AspectXenopus laevis NKAIN3Mammalian NKAIN3Significance
Sequence identityReference~70-80% (predicted)Core functional domains highly conserved
Tissue expressionEnriched in neural tissues, kidney, skinPrimarily brain, kidneyReflects physiological adaptations
Developmental regulationExpression peaks during metamorphosis (predicted)Regulated during embryonic developmentRole in organismal development
Environmental responsivenessDehydration-responsive (hypothesized)Limited environmental responsivenessAdaptation to amphibian lifestyle

What CRISPR/Cas9 strategies are most effective for studying NKAIN3 function in Xenopus laevis?

CRISPR/Cas9 genome editing in Xenopus laevis presents unique challenges due to its allotetraploid genome, but offers powerful approaches for functional analysis of NKAIN3:

sgRNA design considerations:

  • Target shared sequences between homeologs (L and S chromosomes) for complete knockout

  • Design chromosome-specific sgRNAs for selective gene editing when divergent sequences exist

  • Use multiple sgRNAs targeting different exons to increase editing efficiency

Delivery methods:

  • Microinjection of Cas9 protein with sgRNAs into fertilized eggs for germline transmission

  • Tissue-specific expression using tissue-specific promoters

  • Temporal control using inducible Cas9 systems

Validation approaches:

  • T7 endonuclease I assay for initial editing assessment

  • Deep sequencing to characterize editing events

  • RT-qPCR and Western blot to confirm reduced expression

  • Phenotypic analysis focusing on osmoregulation and development

For studying NKAIN3 specifically, targeting conserved functional domains (transmembrane regions or Na+/K+-ATPase interaction domains) is recommended. Researchers should verify that both homeologs are successfully modified, as incomplete editing can lead to compensation and obscure phenotypes.

How can single-cell transcriptomics be applied to understand NKAIN3 expression patterns in Xenopus tissues?

Single-cell RNA sequencing (scRNA-seq) offers unprecedented resolution for studying cell-specific expression of NKAIN3 in Xenopus tissues:

Tissue preparation protocols:

  • Enzymatic dissociation optimization for different Xenopus tissues

  • Nuclei isolation approaches for challenging tissues

  • Cell sorting strategies to enrich for specific populations

Platform selection:

  • Droplet-based methods (10x Genomics) for high-throughput analysis

  • Plate-based methods (Smart-seq2) for greater sequencing depth

  • Spatial transcriptomics to preserve tissue context

Analysis frameworks:

  • Clustering analysis to identify cell populations expressing NKAIN3

  • Trajectory analysis to map developmental or physiological state transitions

  • Co-expression analysis to identify genes functionally related to NKAIN3

Validation approaches:

  • RNA fluorescence in situ hybridization (FISH)

  • Antibody staining in tissue sections

  • Reporter gene constructs for live imaging

Cell TypeExpected NKAIN3 ExpressionAssociated MarkersFunctional Significance
Kidney tubule cellsHighNa+/K+-ATPase, AQP3Osmoregulation
Neural cellsModerate-HighTUBB3, MAP2Membrane potential regulation
Skin ionocytesHighATP6V1A, CA2Ion transport
Muscle cellsLowMYH1, ACTA1Background expression

When designing scRNA-seq experiments, researchers should consider collecting cells under different physiological conditions (normal hydration vs. dehydration) to capture dynamic regulation of NKAIN3 expression .

How can non-specific binding be minimized when using antibodies against Xenopus NKAIN3?

Developing specific antibody-based detection methods for NKAIN3 in Xenopus requires careful optimization:

Antibody selection and validation:

  • Test commercial antibodies raised against conserved epitopes

  • Generate Xenopus-specific antibodies using unique peptide regions

  • Validate using Western blots of tissues with known expression patterns

  • Confirm specificity using knockdown/knockout controls

Western blot optimization:

  • Increase blocking stringency (5% BSA or milk, plus 0.1% Tween-20)

  • Optimize primary antibody concentration (typically 1:500-1:5000 dilution range)

  • Increase wash steps duration and number (5 washes, 5 minutes each)

  • Use monovalent Fab fragments for secondary detection

Immunohistochemistry improvements:

  • Extended blocking with normal serum (10% for 2 hours)

  • Antigen retrieval optimization (citrate buffer, pH 6.0 vs. EDTA buffer, pH 9.0)

  • Antibody adsorption with tissue homogenates from non-expressing tissues

  • Signal amplification methods (tyramide signal amplification) for low abundance

Current data indicates limited availability of validated antibodies for NKAIN3 (only 7 reported) , suggesting researchers may need to develop custom antibodies for optimal results in Xenopus.

What strategies can address protein aggregation during recombinant NKAIN3 purification?

Membrane proteins like NKAIN3 are prone to aggregation during expression and purification. Effective strategies include:

Expression optimization:

  • Reduce expression temperature (16-20°C) to slow protein production

  • Use weaker inducible promoters to prevent overwhelming cellular machinery

  • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

Solubilization approaches:

  • Screen detergent combinations rather than single detergents

  • Add lipids during solubilization (0.1-1 mg/ml cholesterol, PC, PE)

  • Use protein fusion partners that enhance solubility (MBP, SUMO, Trx)

Purification modifications:

  • Include glycerol (10%) throughout purification steps

  • Maintain detergent above critical micelle concentration

  • Add low concentrations of secondary detergents as stabilizers

  • Perform purification at 4°C with protease inhibitors

Aggregation remediation:

  • Size exclusion chromatography to remove aggregates

  • On-column refolding protocols for proteins recovered from inclusion bodies

  • Detergent exchange during purification to more stabilizing detergents

Researchers should be aware that during IMAC purification, several native E. coli proteins commonly co-purify and may be mistaken for the target protein or its degradation products . Verification of protein identity through Western blotting or mass spectrometry is essential.

How can NKAIN3 research in Xenopus laevis contribute to understanding human diseases?

Research on NKAIN3 in Xenopus laevis can provide valuable insights into human disease mechanisms:

Neurological disorders:

  • NKAIN3 variants have been associated with neurological phenotypes

  • Xenopus allows functional testing of human variants through rescue experiments

  • Electrophysiological studies in Xenopus oocytes can reveal functional consequences

Ion transport disorders:

  • Modeling the impact of NKAIN3 variants on Na+/K+-ATPase function

  • Screening potential therapeutic compounds that modulate NKAIN3-Na+/K+-ATPase interaction

  • Understanding compensatory mechanisms that may inform treatment approaches

Developmental disorders:

  • Xenopus embryo manipulations to study NKAIN3's role in development

  • Screening environmental toxicants that disrupt NKAIN3 function

  • Testing genetic interactions with known disease-associated genes

The translational value of Xenopus research is enhanced by combining gene editing, high-resolution imaging, and electrophysiology approaches to study disease-relevant phenotypes at molecular, cellular, and organismal levels.

What are the emerging technologies that will advance NKAIN3 research in the next decade?

Several cutting-edge technologies are poised to transform NKAIN3 research:

Structural biology advancements:

  • Cryo-EM for membrane protein complexes to resolve NKAIN3-Na+/K+-ATPase structure

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Integrative structural modeling combining multiple experimental approaches

Advanced genome engineering:

  • Prime editing for precise genetic modifications without double-strand breaks

  • Base editing for studying specific amino acid variants

  • Tissue-specific conditional alleles for temporal control of gene function

Single-cell multi-omics:

  • Simultaneous profiling of transcriptome, proteome, and metabolome

  • Spatial transcriptomics to map expression in tissue context

  • Live-cell proteomics to track protein dynamics

Artificial intelligence applications:

  • Improved protein structure prediction beyond AlphaFold

  • Machine learning for phenotype analysis and classification

  • Network analysis to position NKAIN3 in broader regulatory contexts

These technologies will help address the current knowledge gaps surrounding NKAIN3, potentially moving it from its current Tdark classification (targets with minimal information) to a better-characterized protein with clear functional understanding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.