Recombinant ATP1B3 is produced using heterologous expression systems. Common platforms include:
| System | Purity | Tag | Applications | Source |
|---|---|---|---|---|
| E. coli | ≥85% (SDS-PAGE) | His tag | ELISA, antibody production | |
| Yeast | ≥90% | Untagged | Functional studies | |
| Baculovirus (insect cells) | ≥85% | Variable | Structural studies |
Example construct: The Xenopus ATP1B3 partial sequence (AA 57–277) includes the extracellular domain and critical ion-binding residues, expressed in yeast with a His tag for purification .
Ion Transport Assays: Used to reconstitute Na+/K+-ATPase activity in lipid bilayers .
Gene Editing: Xenopus embryos serve as models for CRISPR/Cas9-mediated atp1b3 knockout to study developmental defects .
Cancer: Human ATP1B3 overexpression correlates with metastatic potential in gliomas .
Neurological Disorders: Mutations disrupt neuronal ion homeostasis, linked to epilepsy models .
UniGene: Xl.6045
ATP1B3 is a beta subunit of the sodium/potassium-transporting ATPase (Na+/K+-ATPase), which belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins. This integral membrane protein works in conjunction with alpha subunits to establish and maintain electrochemical gradients of Na+ and K+ ions across the plasma membrane. These gradients are essential for osmoregulation, sodium-coupled transport of various molecules, and electrical excitability of nerve and muscle tissues .
The beta subunit plays a critical regulatory role through assembly of alpha/beta heterodimers, controlling the number of sodium pumps transported to the plasma membrane. Specifically, the beta subunit is required for the biosynthesis and trafficking of the alpha subunit to the plasma membrane, making it an essential component for functional expression of the sodium-potassium pump .
In functional Na+/K+-ATPase complexes, the enzyme consists of two main subunits: a large catalytic subunit (alpha) responsible for the ATP hydrolysis and ion transport, and a smaller glycoprotein subunit (beta) that facilitates proper folding, membrane insertion, and functional activity of the complex. While the alpha subunit contains the binding sites for ions, ATP, and cardiotonic steroids, the beta subunit is crucial for the assembly and membrane targeting of the entire complex .
The recombinant Xenopus laevis ATP1B3 protein (amino acids 57-277) contains critical structural elements necessary for its function. The sequence "TMWVMLQTLDDSVPKYRDRVSSPGLMISPKSAGLEIKFSRSKTQSYMEYVQTLNTFLAPYNDSIQA KNEFCPPGLYFDQDEEVEKKTCQFNRTSLGICSGIEDPMFGYGEGKPCIVVKINRIIGLKPEGNP KINCTSKTEDVNLQYFPDNGKIDLMYFPYYGKKTHVNYVQPVVAVKISPSNFTSEELAVECKI HGSRNLKNEDERDKFLGRVTFKVKITE" represents the functional core of the protein .
Comparative analysis between Xenopus laevis ATP1B3 and human ATP1B3 reveals conservation of key functional domains, though with species-specific variations. These differences make the Xenopus model particularly valuable for studying both conserved and divergent aspects of Na+/K+-ATPase function across vertebrates. Specific glycosylation sites and transmembrane domains show strong conservation, underscoring their functional importance in the protein complex assembly and membrane integration.
The beta-3 subunit differs from other beta subunit isoforms (β1, β2) in tissue distribution and affinity for alpha subunits, making it important to understand these distinctions when designing experiments with recombinant ATP1B3. Expression patterns of ATP1B3 vary across tissues, with implications for its role in specialized cellular contexts .
The interaction between ATP1B3 and alpha subunits is critical for the formation of functional Na+/K+-ATPase complexes. Research has shown that beta subunits regulate, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane . This interaction occurs during protein biosynthesis in the endoplasmic reticulum, where the beta subunit facilitates proper folding and trafficking of the alpha subunit.
Evidence from expression studies indicates a competitive relationship between different alpha subunits for association with beta subunits during biosynthesis. When one alpha subunit (e.g., ATP1A3) is overexpressed, it can lead to a reciprocal reduction in another alpha subunit (e.g., ATP1A1), suggesting competition for a limiting factor during biosynthesis. Interestingly, this competition persists even when beta subunits are overexpressed, indicating that the beta subunit itself may not be the limiting factor in sodium pump assembly .
Experimental evidence suggests that alpha subunits may compete for specific chaperones or other factors required for their biosynthesis or to prevent their degradation in the endoplasmic reticulum. This competition mechanism represents an important regulatory layer that limits the total amount of Na+/K+-ATPase to physiological levels .
Several expression systems have been successfully employed for producing recombinant Xenopus laevis ATP1B3, each with distinct advantages depending on research objectives. Yeast expression systems have proven effective for generating ATP1B3 with His-tag modifications, providing good yields for structural and biochemical studies .
The Xenopus laevis oocyte expression system offers a particularly valuable approach for functional studies of ATP1B3. This system has been successfully used for related membrane proteins such as the Menkes ATPase (a copper ATPase), where wild-type ATPase cDNA and GFP fusion constructs were transcribed in vitro with mRNA subsequently injected into oocytes. Expression in oocytes can be analyzed by Western blotting and fluorescence microscopy, with confocal microscopy enabling localization studies of the expressed protein .
Mammalian cell expression systems, particularly HEK293 cells, provide another valuable platform for studying ATP1B3 in a cellular context more similar to human physiology. These systems allow for tetracycline-inducible expression, enabling temporal control of protein production and facilitating studies of protein-protein interactions and trafficking dynamics within the cell .
Each expression system offers different advantages: yeast systems provide high protein yields, Xenopus oocytes excel for electrophysiological studies, and mammalian cells are ideal for studying cellular trafficking and protein-protein interactions in a more native-like environment.
Purification of recombinant ATP1B3 typically involves a multi-step approach tailored to the expression system used. For His-tagged proteins expressed in yeast, immobilized metal affinity chromatography (IMAC) using Ni-NTA resins provides an effective initial purification step . This approach typically yields protein with purity exceeding 90%, suitable for many applications including ELISA and basic biochemical characterization.
For higher purity requirements (>95%), additional purification steps may include:
Size exclusion chromatography to separate the target protein from aggregates and other impurities based on molecular size
Ion exchange chromatography to exploit the charge characteristics of ATP1B3
Hydrophobic interaction chromatography, which can be particularly useful for membrane proteins like ATP1B3
Special considerations must be made for ATP1B3 as a membrane protein. Detergent selection is critical, with mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) or CHAPS often proving effective for solubilization while preserving protein structure and function. For structural studies requiring higher purity, more stringent approaches may be necessary, potentially including affinity chromatography using alpha subunit interactions.
The quality of purified protein should be assessed through multiple methods including SDS-PAGE, Western blotting, mass spectrometry, and functional assays to ensure both purity and biological activity are maintained throughout the purification process.
Assessing the functionality of recombinant ATP1B3 requires multiple complementary approaches to evaluate both its structural integrity and biological activity. A comprehensive evaluation should include:
Heterodimer formation assessment: Since ATP1B3 functions as part of a heterodimeric complex with alpha subunits, co-immunoprecipitation or cross-linking studies can verify proper complex formation. This is critical as the beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane .
Membrane localization studies: Confocal microscopy using fluorescently tagged ATP1B3 (such as GFP fusion constructs) can confirm proper trafficking to the plasma membrane. Previous studies with related proteins have shown that fusion proteins can localize primarily to the plasma membrane, as assessed by confocal microscopy .
ATPase activity assays: Functional Na+/K+-ATPase activity can be measured through ATP hydrolysis assays, typically by quantifying inorganic phosphate release or through coupled enzyme assays.
Ouabain binding studies: As a specific inhibitor of Na+/K+-ATPase, ouabain binding assays can confirm the presence of properly folded and assembled pump complexes.
Ion transport measurements: Electrophysiological techniques, particularly in Xenopus oocyte expression systems, can directly measure ion transport function through methods such as two-electrode voltage clamp or patch clamp recordings.
When examining data from these assays, researchers should be aware that the total amount of Na+/K+-ATPase appears to be regulated at multiple levels, and expression of recombinant ATP1B3 may influence levels of endogenous subunits through competitive mechanisms .
Recombinant ATP1B3 provides a powerful tool for investigating paralog dependencies in disease contexts. Recent research has identified ATP1B3 as a context-specific, paralog-related dependency in acute myeloid leukemia (AML). When its paralog ATP1B1 is poorly expressed, elimination of ATP1B3 leads to destabilization of the Na+/K+-ATPase pump, inducing cell death .
Researchers can utilize recombinant ATP1B3 to investigate these mechanisms through several approaches:
Expression rescue experiments: By introducing recombinant ATP1B3 into cells where endogenous ATP1B3 has been knocked down or knocked out, researchers can validate the specificity of observed phenotypes. These experiments can be particularly informative when combined with manipulation of paralog expression (e.g., ATP1B1).
Structure-function studies: Point mutations or domain swaps between ATP1B3 and its paralogs can identify critical regions responsible for paralog-specific functions. Research has shown that loss of ATP1B3 in AML cells induced cell death in vitro and reduced leukemia burden in vivo, effects that could be rescued by stabilizing ATP1A1 through overexpression of ATP1B1 .
Interaction partner identification: Using recombinant ATP1B3 as bait in pull-down or co-immunoprecipitation assays can identify novel binding partners that might differ between paralogs, potentially explaining paralog-specific functions.
Tissue-specific dependencies: Since tissue-specific differences in paralog expression can create vulnerabilities, recombinant ATP1B3 can be used to model these dependencies in various cellular contexts. ATP1B1 expression is regulated through epigenetic silencing in hematopoietic lineage cells, creating a dependency on ATP1B3 that could be exploited therapeutically .
These approaches can reveal fundamental insights into the biology of Na+/K+-ATPase and identify potential therapeutic strategies targeting paralog dependencies, as demonstrated by the potential of ATP1B3 as a therapeutic target for AML and other hematologic malignancies with low expression of ATP1B1 .
Investigating ATP1B3 interactions with alpha subunits requires specialized techniques that can capture the dynamics and specificity of these membrane protein interactions. Several effective methodologies include:
Co-expression and co-immunoprecipitation: By co-expressing tagged versions of ATP1B3 and various alpha subunits (ATP1A1, ATP1A2, ATP1A3, etc.), researchers can assess preferential interactions through co-immunoprecipitation followed by Western blotting. This approach has revealed that when ATP1A3 is induced, the level of ATP1A1 is reciprocally reduced, suggesting competition for limiting factors during biosynthesis .
Förster resonance energy transfer (FRET): By tagging ATP1B3 and alpha subunits with appropriate fluorophore pairs, FRET can detect direct interactions between these subunits in living cells, providing spatial and temporal information about their association.
Bimolecular fluorescence complementation (BiFC): This technique involves splitting a fluorescent protein and fusing each half to the proteins of interest. When ATP1B3 and an alpha subunit interact, the fluorescent protein halves come together, generating a fluorescent signal.
Surface plasmon resonance (SPR): Using purified recombinant proteins, SPR can quantify binding kinetics and affinities between ATP1B3 and various alpha subunits, revealing potential differences in interaction strength.
Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry analysis can identify specific residues involved in ATP1B3-alpha subunit interactions, providing structural insights into the interaction interface.
Data from these techniques should be interpreted with awareness that the total amount of Na+/K+-ATPase appears to be regulated, with alpha subunits potentially competing for limiting factors during biosynthesis. Experiments should include controls to account for these competitive effects and the potential influence of overexpression on endogenous protein levels .
Recombinant ATP1B3 serves as an excellent model for investigating fundamental questions about membrane protein biogenesis and trafficking. Several experimental approaches can leverage this system:
Pulse-chase experiments with fluorescent or radioactive labeling: These can track the synthesis, folding, and membrane insertion of ATP1B3 and its alpha subunit partners in real time. Data from such studies have shown that the beta subunit is required for the biosynthesis and trafficking of the alpha subunit to the plasma membrane .
Endoplasmic reticulum (ER) retention mutants: By introducing mutations that cause ER retention, researchers can identify critical residues or domains required for proper trafficking. The presence of core-glycosylated forms of beta subunits in the ER provides a marker for trafficking defects, as observed with certain alpha subunit mutations .
Fluorescence microscopy with compartment-specific markers: Colocalization studies using markers for the ER, Golgi, and plasma membrane can map the trafficking pathway of ATP1B3. The ATP1B3-GFP chimera has been observed to localize primarily to the plasma membrane as assessed by confocal microscopy .
Glycosylation analysis: As ATP1B3 undergoes glycosylation during processing, analyzing glycosylation patterns can provide insights into trafficking progression. A faster-migrating form of beta subunit on SDS-PAGE often represents the core-glycosylated form in the endoplasmic reticulum .
Density gradient centrifugation: This technique can physically separate different cellular compartments to track the movement of ATP1B3 through the secretory pathway. Previous work has shown redistribution of certain Na+/K+-ATPase mutants from plasma membrane to ER by sucrose density centrifugation .
These approaches can reveal how ATP1B3 contributes to the assembly and trafficking of the Na+/K+-ATPase complex, providing insights applicable to other multisubunit membrane proteins. Research has shown that competition between alpha subunits during biosynthesis may involve factors beyond simple beta subunit availability, suggesting additional regulatory mechanisms in Na+/K+-ATPase expression .
Working with recombinant ATP1B3 presents several technical challenges common to membrane proteins, each requiring specific troubleshooting approaches:
Low expression yields: ATP1B3 as a membrane protein often expresses at lower levels than soluble proteins. This can be addressed by:
Optimizing codon usage for the expression host
Testing different promoters and induction conditions
Using specialized expression strains or cell lines
Exploring fusion partners that may enhance expression
Protein misfolding and aggregation: As a component of a multisubunit complex, ATP1B3 may misfold without its alpha subunit partner. Strategies to improve folding include:
Co-expression with appropriate alpha subunits
Expression at lower temperatures to slow protein synthesis
Addition of chemical chaperones to the culture medium
Inclusion of stabilizing agents during purification
Detergent selection challenges: Finding detergents that effectively solubilize ATP1B3 while maintaining its structure and function can be difficult. A systematic approach includes:
Screening multiple detergent classes (non-ionic, zwitterionic, etc.)
Testing detergent mixtures for improved solubilization
Considering lipid-detergent mixed micelles to better mimic native membrane environments
Using nanodiscs or amphipols for detergent-free stabilization
Loss of function during purification: Functional activity may decrease during purification steps. This can be mitigated by:
Including stabilizing ions (Na+, K+) in all buffers
Adding cholesterol or specific lipids that support function
Minimizing exposure to harsh conditions (extreme pH, high salt)
Performing functional assays throughout purification to monitor activity
Glycosylation heterogeneity: As a glycoprotein, ATP1B3 may exhibit heterogeneous glycosylation depending on the expression system. This can be addressed by:
Using expression systems with more homogeneous glycosylation (e.g., engineered yeast strains)
Enzymatic deglycosylation for applications where glycosylation is not required
Site-directed mutagenesis to remove specific glycosylation sites if they interfere with the research goal
When interpreting experimental results, it's important to consider that the presence of recombinant ATP1B3 may affect levels of endogenous sodium pump subunits through competitive mechanisms during biosynthesis .
Recombinant ATP1B3 provides an excellent platform for studying post-translational regulation of the sodium-potassium pump. Several methodological approaches can yield valuable insights:
When designing these experiments, researchers should consider that the total amount of Na+/K+-ATPase appears to be regulated such that expression of one subunit can affect levels of others. Controls should be included to account for these compensatory mechanisms and their impact on experimental interpretation .
Recent research has revealed ATP1B3 as a context-specific dependency in acute myeloid leukemia (AML), highlighting its significance in cancer biology and potential as a therapeutic target. This paralog dependency arises from tissue-specific differences in the expression of paralog genes, creating selective vulnerabilities .
In AML, ATP1B3 has been identified as a lethal selective paralog dependency due to epigenetic silencing of its paralog ATP1B1 in hematopoietic lineage cells. When ATP1B1 is poorly expressed, elimination of ATP1B3 leads to destabilization of the Na+/K+-ATPase pump, inducing cell death. Loss of ATP1B3 in AML cells reduced leukemia burden in vivo, an effect that could be rescued by stabilizing ATP1A1 through overexpression of ATP1B1 .
This mechanism represents a promising therapeutic strategy based on synthetic lethality, a concept that has shown clinical success in other contexts such as PARP inhibitors in breast and ovarian cancers. Several experimental approaches can further explore this potential:
Targeted degradation approaches: Proteolysis-targeting chimeras (PROTACs) or molecular glues could be developed to specifically degrade ATP1B3 in AML cells.
Small molecule inhibitors: Compounds that disrupt the interaction between ATP1B3 and alpha subunits could destabilize the sodium pump specifically in cells lacking ATP1B1.
Allosteric modulators: Molecules that bind ATP1B3 and alter its conformation could affect its function without necessarily preventing pump assembly.
Selective expression modulation: Approaches targeting the epigenetic regulation of ATP1B3 or ATP1B1 could alter their expression ratios and potentially induce synthetic lethality.
When designing such studies, researchers should consider potential resistance mechanisms, such as upregulation of ATP1B1 or compensatory expression of other beta subunit isoforms. Combining ATP1B3 targeting with other therapies may prevent or delay resistance development .