Recombinant Xenopus laevis Solute carrier family 25 member 46-B (slc25a46-b)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Xenopus laevis slc25a46-b

Gene structure:

  • slc25a46-b is annotated in Xenopus laevis as a paralog of human SLC25A46 (Xenbase ID: XB-GENE-6255737) .

  • Structural features include six transmembrane helices typical of the SLC25 mitochondrial carrier family, with conserved substrate-binding motifs.

Protein properties:

PropertyValue/Description
Molecular weight~46 kDa (predicted)
Subcellular localizationMitochondrial outer membrane
FunctionRegulates mitochondrial fission
Conserved domainsSolute carrier 25 superfamily domain

Functional Insights from Homologous Systems

SLC25A46 orthologs across species exhibit conserved roles in mitochondrial dynamics:

SpeciesFunctionKey FindingsSource
Human (H. sapiens)Mitochondrial fusion/fission balanceMutations cause optic atrophy, neuropathy
Mouse (M. musculus)Axonal mitochondrial aggregationKnockout models show cerebellar degeneration
C. elegansMitochondrial fusion via FZO-1/MFN2Loss leads to fragmented mitochondria
X. laevisPutative fission regulationAnnotated role in membrane dynamics

Hypothesized role of Xenopus slc25a46-b:

  • Likely interacts with mitochondrial dynamics proteins (e.g., MFN2, DRP1) based on conserved pathways .

  • May regulate cristae architecture or lipid transport, as observed in human SLC25A46 mutants .

Recombinant Expression and Experimental Approaches

While recombinant Xenopus slc25a46-b has not been explicitly studied, methods for homologs suggest:

Expression systems:

  • Escherichia coli: Used for human SLC25A42 (source 1) and murine SLC25A46 , yielding inclusion bodies requiring refolding.

  • Mammalian cells: GFP-tagged constructs (e.g., HEK293T) validate mitochondrial localization .

Functional assays:

Assay TypeApplicationExample from Literature
Liposome reconstitutionTransport kinetics (CoA, nucleotides)Human SLC25A42 in
BN-PAGEProtein complex analysisSLC25A46-MFN1/2 interactions in
CRISPR/Cas9 knockoutsPhenotypic analysis (mitochondrial morphology)Mouse models in

Research Gaps and Future Directions

  • Structural studies: No cryo-EM or X-ray data exist for Xenopus slc25a46-b. Homology modeling (e.g., Robetta, as in ) could predict substrate-binding pockets.

  • Pathogenic variants: No disease-associated mutations reported in Xenopus, but human variants (e.g., p.Arg347Cys ) highlight residues critical for function.

  • Therapeutic targeting: AAV-mediated gene delivery rescued murine SLC25A46 deficiency , suggesting potential for Xenopus models.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development according to your specifications.
Synonyms
slc25a46-b; Solute carrier family 25 member 46-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc25a46-b
Target Protein Sequence
MQPRRPDRFDGLEYRGTSWGRGDGDVPPYQSSFPARSLSSSGDLSQQWVTSPPDIPGSRN LHWGEKSPQYGADSNAGPPAFGEENSGSSGEQVNRFAGFGIGLASLFTENVLAHPCIVLR RQCQVNYHAQNYQLSPFSIVNIMYNFTKTQGPRALWKGMGSTFIVQGISLGAEGMLSEFT HLPRELSHKWNLKQLGGHLLLKGLVYVIVTPFYSASLIETVQSEIIHDNPGILDCLKEGI GRVLNLGVPYSKRLLPLLVLTFPTVLHGILHYIISSTIQKCVLFFIKKRSPPQLPAEGSN AVQNKLEDYFPELLANFAASLCADVLLYPLETVMHRLHIQGTRTIIDNTDLGHEVVPINT QYEGLKDCINTIKREEGGLGFYKGFGAVVVQYTLHAIVLQITKIIYSSVVQTAR
Uniprot No.

Target Background

Function
This protein may play a role in mitochondrial dynamics by regulating mitochondrial membrane fission.
Database Links

KEGG: xla:494746

UniGene: Xl.49713

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is SLC25A46-B and what is its fundamental role in cellular function?

SLC25A46-B is a mitochondrial protein that belongs to the solute carrier family 25. In Xenopus laevis, this protein plays a crucial role in mitochondrial dynamics and cristae maintenance, similar to its human ortholog. The protein contains 414 amino acids and is characterized by specific structural domains that facilitate its function at the mitochondrial outer membrane .

SLC25A46-B interacts with mitochondrial fusion proteins (such as MFN2, OPA1) and components of the MICOS complex, suggesting its involvement in maintaining mitochondrial morphology and function . Its expression is particularly prominent in the nervous system, which helps explain why mutations in this gene primarily manifest as neurological disorders . Methodologically, researchers can confirm its subcellular localization through co-immunostaining with mitochondrial markers like TOM20, which has been successfully employed in studies of the human ortholog .

How does the amino acid sequence of Xenopus laevis SLC25A46-B contribute to its function?

The amino acid sequence of Xenopus laevis SLC25A46-B (UniProt: Q63ZR7) contains highly conserved regions that are essential for its function . The full amino acid sequence, consisting of 414 amino acids, includes specific domains that facilitate protein-protein interactions and integration into the mitochondrial outer membrane .

Particularly important are the conserved regions that allow for interaction with other mitochondrial proteins. To study structure-function relationships, researchers should focus on highly conserved residues across species, as these are likely critical for the protein's function. Mutations in these conserved regions typically result in more severe phenotypes in disease models. For instance, the arginine residue at position 257 (corresponding to human Arg257) is highly conserved and mutations at this position (p.R257Q) have been associated with neurological disorders .

What are the optimal storage and handling conditions for recombinant SLC25A46-B protein?

Recombinant SLC25A46-B protein stability is maximized when stored properly. The recommended storage conditions include keeping the protein at -20°C for regular storage, or at -80°C for extended preservation . The protein is typically prepared in a Tris-based buffer with 50% glycerol, which has been optimized for stability .

For experimental work, it is advisable to avoid repeated freezing and thawing cycles, as this can lead to protein degradation and loss of functionality. Working aliquots should be prepared and stored at 4°C for up to one week to maintain protein integrity . When manipulating the protein for experimental purposes, researchers should consider its native environment (mitochondrial membrane) and include appropriate detergents or lipid environments in experimental buffers to maintain proper folding and activity.

What expression systems are most effective for producing functional recombinant SLC25A46-B protein?

For producing recombinant SLC25A46-B protein, mammalian expression systems (particularly HEK293T cells) have proven effective for functional studies of the human ortholog and are likely suitable for the Xenopus protein as well . These systems provide appropriate post-translational modifications and cellular machinery for proper protein folding and localization.

When designing expression constructs, researchers should consider adding epitope tags (such as HA-tag) at positions that don't interfere with protein function or localization. This approach has been successfully used in studies of human SLC25A46 variants . For protein purification, including a cleavable tag can facilitate obtaining the native protein structure after purification.

The expression region should include positions 1-414 to ensure the full-length protein is produced . It's important to note that some mutations may affect protein stability, so expression conditions may need optimization depending on the specific construct being studied. Temperature-controlled expression (typically lower than 37°C) can improve the yield of properly folded protein, especially for unstable variants.

How can I design mutation studies to investigate the impact of specific amino acid substitutions on SLC25A46-B function?

When designing mutation studies for SLC25A46-B, researchers should focus on highly conserved residues across species, particularly those already implicated in human disease. Based on human ortholog studies, mutations like p.R257Q, p.G249D, p.L138R, and p.T142I have significant impacts on protein stability and function and could serve as models for Xenopus studies .

Methodologically:

  • Utilize site-directed mutagenesis on expression constructs

  • Confirm mutations through sequencing

  • Transiently transfect cells (such as HEK293T)

  • Assess protein stability through immunoblotting

  • Evaluate subcellular localization through immunostaining with markers like TOM20

  • Measure functional impacts through mitochondrial morphology and function assays

Protein stability can be quantified through immunoblotting and densitometry analysis across multiple experiments, comparing mutant variants to wild-type protein levels . Subcellular localization should be assessed using confocal microscopy to determine if mutant proteins properly target to mitochondria or mislocalize to other cellular compartments .

What techniques are most effective for assessing SLC25A46-B interactions with other mitochondrial proteins?

To effectively study SLC25A46-B interactions with other mitochondrial proteins, several complementary approaches should be employed:

TechniqueApplicationAdvantagesConsiderations
Co-immunoprecipitationIdentification of physical protein interactionsDetects native complexesRequires high-quality antibodies or epitope tags
Proximity labelingMapping the protein interactomeIdentifies transient interactionsRequires optimization of labeling conditions
Fluorescence resonance energy transfer (FRET)Studying dynamic interactions in living cellsProvides spatiotemporal informationRequires careful control experiments
Split-GFP complementationVisualizing protein interactions in situDirect visualization in living cellsMay interfere with protein function
Blue native PAGEPreserving native protein complexesMaintains complex integrityLimited to stable complexes

Studies on human SLC25A46 have demonstrated interactions with mitochondrial fusion proteins (MFN2, OPA1) and components of the MICOS complex . Similar interaction partners likely exist for the Xenopus ortholog and can be investigated using these approaches. When designing such experiments, researchers should consider using controls to validate specific interactions and employ appropriate detergents that preserve membrane protein interactions.

How can Xenopus SLC25A46-B be utilized as a model system for studying human neurological disorders?

Xenopus laevis provides an excellent model system for studying SLC25A46-related human neurological disorders due to the conservation of protein function across species. Human SLC25A46 mutations have been associated with a spectrum of neurological conditions, including optic atrophy, axonal neuropathy, ataxia, and cerebellar hypoplasia .

To develop an effective Xenopus model:

  • Generate transgenic Xenopus expressing mutant forms of SLC25A46-B corresponding to human disease variants

  • Utilize CRISPR/Cas9 gene editing to create knockout or knock-in models

  • Assess neurological development, particularly focusing on the optic nerve and cerebellum

  • Perform detailed histological analysis of neural tissues

  • Evaluate mitochondrial morphology and function in affected tissues

The advantage of Xenopus as a model includes its well-characterized developmental stages, transparent embryos allowing for in vivo imaging, and the ability to perform rescue experiments. For instance, researchers could test if human SLC25A46 can rescue phenotypes in Xenopus SLC25A46-B mutants, similar to experiments performed in mouse models where human SLC25A46 successfully rescued the phenotype of Slc25a46 mutant mice .

What is the correlation between SLC25A46 protein stability and disease severity in neurological disorders?

Research has established a clear inverse correlation between SLC25A46 protein stability and disease severity. Studies of various patient-derived mutations show that variants causing the most severe destabilization of the protein are associated with the most devastating clinical outcomes, including early lethality .

VariantProtein StabilityClinical PresentationDisease Severity Score
p.T142INearly eliminatedLeigh syndrome, death at 14 months5.0
p.P333LSeverely reducedDeath at 3 months5.0
p.L341PSeverely reducedDeath at 4 weeks5.0
p.R340CIntermediately reducedOptic atrophy, neuropathy, cerebellar atrophy by age 283.0
p.E335DIntermediately reducedBilateral cerebellar encephalomalacia by age 53.5
p.R257QNearly normalOptic atrophy, mild neuropathy2.0
p.G249DNearly normalOptic atrophy in childhood, late-onset neuropathy (40s), no cerebellar abnormalities1.2

This pattern suggests that the degree of protein destabilization directly impacts disease progression and severity . Methodologically, researchers can predict the severity of novel mutations by assessing protein stability through transient expression studies and comparing levels to wild-type protein. This approach provides valuable prognostic information for patients with newly identified variants .

How do different SLC25A46 mutations impact mitochondrial morphology and function?

Different SLC25A46 mutations have varying effects on mitochondrial morphology and function, depending on the mutation's location and impact on protein stability. Studies have shown that SLC25A46 plays a critical role in maintaining mitochondrial dynamics and cristae structure .

Severe mutations that drastically reduce protein levels (such as p.T142I and p.P333L) lead to profound mitochondrial abnormalities, including:

  • Hyperfused mitochondrial networks

  • Abnormal cristae architecture

  • Impaired mitochondrial respiration

  • Compromised mitochondrial DNA maintenance

  • Altered calcium handling

These changes are particularly impactful in neurons, explaining the predominant neurological phenotypes observed in patients. In contrast, milder mutations (like p.R257Q and p.G249D) that maintain near-normal protein levels show less severe mitochondrial defects .

To assess mitochondrial impacts experimentally, researchers should employ:

  • Live-cell imaging with mitochondrial dyes

  • Electron microscopy for ultrastructural analysis

  • Respirometry to measure mitochondrial function

  • Analysis of mitochondrial fusion and fission dynamics

  • Assessment of mitochondrial membrane potential

These approaches can be applied to both cell culture models expressing mutant SLC25A46 variants and tissues from animal models.

What molecular mechanisms underlie SLC25A46-B's role in mitochondrial dynamics?

SLC25A46-B functions as a key regulator of mitochondrial dynamics through its interactions with both fusion and fission machinery, as well as components of the MICOS complex responsible for cristae structure . As a mitochondrial outer membrane protein, it serves as a critical adaptor that helps coordinate multiple aspects of mitochondrial function.

The molecular mechanisms include:

  • Interaction with fusion proteins MFN2 and OPA1, potentially regulating their activity

  • Association with MICOS complex components, maintaining proper cristae junctions

  • Possible involvement in lipid transfer between mitochondrial membranes

  • Regulation of mitochondrial contact sites with other organelles, such as endoplasmic reticulum

To experimentally assess these mechanisms, researchers can use:

  • Proximity labeling approaches to identify interaction partners

  • Super-resolution microscopy to visualize cristae structure

  • Lipidomic analysis to evaluate membrane composition changes

  • Time-lapse imaging of labeled mitochondria to assess dynamics

Disruption of SLC25A46 function typically results in hyperfused mitochondria, suggesting it may normally promote mitochondrial fission or limit fusion . Additionally, its role in cristae maintenance appears critical for proper respiratory chain function, as evidenced by the neuronal sensitivity to its disruption.

How do mutations in conserved domains of SLC25A46-B affect its interaction with other mitochondrial proteins?

Mutations in conserved domains of SLC25A46-B can significantly impact its interactions with partner proteins, leading to dysfunction in mitochondrial dynamics and structure. Research on the human ortholog has shown that different mutations have varying effects on protein stability and localization, which in turn affect interaction capabilities .

Several key observations from studies of human variants:

  • Severely destabilizing mutations (p.T142I, p.P333L) essentially eliminate all protein interactions due to lack of protein

  • Mutations affecting mitochondrial targeting (like p.R340C) show diffuse cytoplasmic localization and compromise interactions with mitochondrial partners

  • Variants that maintain proper localization but alter specific protein domains may selectively disrupt certain interactions while preserving others

To study these effects in Xenopus SLC25A46-B, researchers should:

  • Create equivalent mutations in conserved domains

  • Assess protein localization through immunofluorescence

  • Perform co-immunoprecipitation experiments with known partners

  • Use proximity labeling approaches to identify altered interaction profiles

The results from such studies can provide important insights into structure-function relationships and help identify critical domains for specific protein interactions, potentially guiding therapeutic strategies.

What cellular pathways are disrupted in SLC25A46-B deficiency models?

SLC25A46-B deficiency disrupts multiple cellular pathways, with pronounced effects on neuronal function and development. Based on studies of the mouse ortholog and human patients, key affected pathways include:

Cellular PathwayImpact of SLC25A46 DeficiencyExperimental Assessment Methods
Mitochondrial fusion/fission balanceHyperfused mitochondrial networksLive-cell imaging, electron microscopy
Oxidative phosphorylationReduced respiratory capacityRespirometry, ATP production assays
Calcium homeostasisAltered calcium bufferingCalcium imaging, electrophysiology
Neuronal developmentDisrupted cytoarchitecture in cerebellum and retinaHistopathology, neurodevelopmental markers
Axonal transportCompromised movement of mitochondria in axonsLive imaging of labeled mitochondria in neurons
Neuromuscular junction formationAbnormal neuromuscular junctionsElectrophysiology, neuromuscular junction staining
Apoptotic signalingIncreased sensitivity to certain apoptotic stimuliApoptosis assays, caspase activation

Mouse models of SLC25A46 deficiency have revealed previously unrecognized pathologies, including disrupted cytoarchitecture in the cerebellum and retina, and abnormalities in the neuromuscular junction . Additionally, an unexpected lymphoid phenotype was observed, suggesting broader impacts beyond the nervous system . These findings highlight the importance of comprehensive phenotyping when developing new model systems for SLC25A46-B deficiency.

How is SLC25A46-B conserved across species and what does this reveal about its essential functions?

SLC25A46-B demonstrates remarkable evolutionary conservation across vertebrate species, indicating its fundamental importance in cellular function. Comparative genomic analyses reveal several key insights:

  • The protein contains highly conserved domains across species from fish to mammals, suggesting evolutionary constraint due to essential functions

  • Certain residues, particularly those involved in protein-protein interactions or membrane integration, show near-perfect conservation

  • Pathogenic mutations in humans often affect residues that are identical in Xenopus laevis SLC25A46-B

For example, the arginine at position 257 (human R257, mutated in some patients to R257Q) is conserved in Xenopus and across numerous other species . This high degree of conservation explains why mutations at this position can cause disease despite the residue not being completely eliminated. Similarly, glycine 249 (human G249D variant) is conserved in amphibians, suggesting an important structural role .

To study evolutionary aspects experimentally, researchers can perform phylogenetic analyses, complementation studies across species (e.g., can human SLC25A46 rescue Xenopus SLC25A46-B deficiency?), and identify rapidly vs. slowly evolving domains within the protein sequence.

What are the key differences between amphibian SLC25A46-B and mammalian orthologs?

While SLC25A46-B maintains high conservation across species, there are notable differences between amphibian and mammalian orthologs that may impact experimental design and interpretation:

  • Sequence variations exist primarily in less conserved regions, with the core functional domains showing high similarity

  • Xenopus laevis, as a tetraploid species, contains two homeologs (SLC25A46-A and SLC25A46-B) compared to the single gene in mammals

  • Regulatory elements controlling expression may differ, potentially resulting in tissue-specific expression pattern differences

  • Post-translational modifications may vary between species, affecting protein function or regulation

When using Xenopus SLC25A46-B for studying human disease-related mechanisms, researchers should be aware of these differences. Cross-species rescue experiments provide valuable insights - the human SLC25A46 ortholog has been demonstrated to rescue the phenotype in mouse models, suggesting functional conservation despite sequence differences .

For experimental design, researchers should consider:

  • Focusing on highly conserved domains when studying disease mutations

  • Accounting for potential redundancy between Xenopus homeologs

  • Validating protein interaction partners, as these may vary somewhat between species

  • Comparing expression patterns across tissues in both amphibian and mammalian systems

How can comparative studies between Xenopus and human SLC25A46 advance our understanding of disease mechanisms?

Comparative studies between Xenopus and human SLC25A46 offer unique advantages for understanding disease mechanisms, particularly for neurological disorders. The amphibian model provides complementary insights to mammalian models through several approaches:

  • Testing evolutionary conservation of function through rescue experiments

  • Utilizing the advantages of Xenopus embryology for studying developmental impacts:

    • External development allowing easy observation

    • Rapid development facilitating experimental timelines

    • Ability to manipulate single embryonic cells or tissues

  • Establishing genotype-phenotype correlations across species

  • Testing hypotheses about structure-function relationships in conserved domains

To maximize the translational value of such studies, researchers should:

  • Create equivalent mutations in Xenopus to those identified in human patients

  • Focus on conserved phenotypes (optic atrophy, cerebellar development, neuronal function)

  • Employ rescue experiments with human variants to determine functional equivalence

  • Use the Xenopus system for high-throughput screening of genetic or pharmacological modifiers

The strong correlation between protein stability and disease severity observed in human patients provides a testable hypothesis in Xenopus models. Researchers can generate a series of mutations affecting protein stability to different degrees and assess the resulting phenotypes, potentially identifying therapeutic windows for intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.