Recombinant Xenopus laevis Spastin (spast)

Shipped with Ice Packs
In Stock

Description

General Information

Spastin, encoded by the SPAST gene, is a highly conserved AAA (ATPase Associated with diverse cellular Activities) protein that plays a crucial role in microtubule dynamics and cellular functions . Mutations in the SPAST gene are associated with spastic paraplegia 4, the most frequent form of autosomal dominant spastic paraplegia . Spastin functions as a microtubule-severing enzyme, regulating microtubule abundance, mobility, and distribution within the cell . It is essential for the biogenesis and maintenance of complex microtubule arrays found in axons, spindles, and cilia .

Protein Function and Structure

Spastin is a member of the AAA protein family, which participates in various cellular activities, including the regulation of cell components and proteins . The protein is found throughout the body, with a significant presence in nerve cells or neurons . Spastin influences microtubule function by regulating their length and disassembling them when they are no longer needed . Microtubules are vital for maintaining cell structure (cytoskeleton), transporting organelles, and facilitating cell division . Microtubule severing enzymes like spastin, katanin, and fidgetin modulate the microtubule cytoskeleton and are critical in neuronal cell biology . These enzymes bind to microtubules and create internal breaks in the microtubule lattice .

Role in Cellular Processes

Spastin is involved in several cellular processes:

  • Axon Biology: Spastin plays a key role in regulating microtubule organization and axonal transport, which is essential for axon growth, branching, and regeneration .

  • Cytokinesis and Nuclear Envelope Reassembly: Spastin cooperates with the ESCRT-III complex during the abscission step of cytokinesis and nuclear envelope reassembly during anaphase . It is recruited to the midbody, possibly by IST1, and participates in membrane fission during abscission . Spastin is also recruited to the nuclear membrane by IST1, mediating microtubule severing, which promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase .

  • Microtubule Repair: Spastin inflicts nanoscale damage throughout the microtubule lattice, which is counteracted by the spontaneous incorporation of GTP-bound tubulin, forming GTP-islands . These GTP-islands create points where microtubules can be rescued from depolymerization and regrowth .

Xenopus laevis Model System

Xenopus laevis, the African clawed frog, is a widely used model organism in developmental biology. Xenopus oocytes and embryos are valuable tools for studying early developmental processes, including axis formation, cell differentiation, and signal transduction . Studies involving Xenopus have provided insights into the function and regulation of proteins like Spastin.

Spastin and Spastic Paraplegia

Mutations in the SPAST gene cause spastic paraplegia 4, a hereditary neurological disorder characterized by muscle stiffness and weakness in the legs . Spastin's role in maintaining microtubule function is crucial for the long-term health and function of neurons, and its dysfunction leads to axonal degeneration and the development of spastic paraplegia .

Research Findings

StudyFindings
R-spondins as BMP receptor antagonists in Xenopus early development R-spondins antagonize BMP signaling and act with BMP antagonists for proper axial patterning during Xenopus embryogenesis. Overexpression of rspo2 induces spina bifida with reduced head structures, suggesting it does not sequester BMP ligands.
Katanin contributes to interspecies spindle length scaling in Xenopus Katanin p60 localizes more strongly to X. tropicalis than X. laevis spindle poles. X. tropicalis p60 co-pellets with taxol-stabilized microtubules in the presence of ATPγS, indicating increased microtubule affinity. Recombinant Maltose Binding Protein (MBP)-tagged X. laevis sperm progressed through interphase in the extract.
The Role of Spastin in Axon Biology Spastin regulates microtubule organization and axonal transport, influencing axon growth, branching, and regeneration. Spastin generates nanoscale damage throughout the MT lattice, counteracted by GTP-bound tubulin incorporation, forming GTP-islands. Microtubule repair is prevalent at microtubule crossovers and bundles, where microtubule severing enzymes are present in high levels.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spast; spg4; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
spast
Target Protein Sequence
MNSPGGRNDKKKPVTPAAETGPGSPTTPPSTETQVVLAPPSPHKRNLHLFSYPLLAVFSL LRFLAFQLGLLFVWCCELLSRSVMADKGRTVASTAAAQDRPQEPEVVRSYHQQAFQYISL ALRVDEEEKDQKEQAVQWYKKGIEELEKGIAVPISGKGEQYDRARRLQAKMSTNLIMAKD RLQLLAKLQADIQGPHSQMEVCSDNTNLPCRNGLLKPEKGAVPKKKDPPPITSNSYSRTK APPKSGSLGNRIPNCTSVPTSARQAGAHTPSNRGATGKNNTRTNKPATPTTAVRKKDMKN LRNVDSNLANLILNEIVDSGPSVKFADIAGQDLAKQALQEIVILPSIRPELFTGLRAPAR GLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFSVARELQPS IIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDDAV LRRFTKRVYVALPNEETRLVLLKNLLSKQGNPLSEKELTQLSRLTEGYSGSDITALAKDA ALGPIRELKPEQVKNMAASEMRNMKYSDFLGSLKKIKCSVSHSTLESYIRWNQDFGDTTV
Uniprot No.

Target Background

Function

Spastin is an ATP-dependent microtubule-severing protein that specifically targets and cleaves polyglutamylated microtubules. It exhibits a preference for microtubules with short polyglutamate tails; severing activity increases with the number of glutamates per tubulin (from one to eight), but decreases beyond this threshold. Microtubule severing facilitates the reorganization of cellular microtubule arrays and the release of microtubules from the centrosome post-nucleation. Spastin is essential for membrane trafficking between the endoplasmic reticulum (ER) and the Golgi apparatus, and for completing cytokinesis. It also plays a crucial role in axon growth and branching.

Database Links

KEGG: xla:446560

UniGene: Xl.32426

Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus.

Q&A

What is Spastin (SPAST) and what are its key cellular functions?

Spastin (SPAST) is a member of the AAA (ATPases Associated with diverse cellular Activities) protein family that plays critical roles in microtubule dynamics and cellular organization. Its primary function is microtubule severing, which is essential for the biogenesis and maintenance of complex microtubule arrays in axons, spindles, and cilia. Spastin functions in several key cellular processes:

  • Abscission during cytokinesis in cooperation with the ESCRT-III complex

  • Nuclear envelope reassembly during anaphase

  • Microtubule severing to promote nuclear envelope sealing

  • Mitotic spindle disassembly during late anaphase

  • Recruitment to cellular structures via interaction proteins like IST1

Mutations in the SPAST gene are associated with Hereditary Spastic Paraplegia, particularly Spastic Paraplegia 4, Autosomal Dominant, underscoring its importance in maintaining neuronal function .

Why use Xenopus laevis as a model for studying Spastin?

Xenopus laevis offers numerous advantages as a model system for studying proteins like Spastin:

  • Evolutionary conservation of key protein domains while maintaining sufficient distance from mammals to distinguish species-specific adaptations from conserved features

  • Large, manipulable eggs and embryos that facilitate biochemical and cellular studies

  • Well-established protocols for protein expression and purification

  • Ease of breeding in laboratory settings using human gonadotrophin injection

  • Availability of genetically-defined inbred strains and clones for controlled experiments

  • Extensive research tools including transgenic animals, monoclonal antibodies, and molecular probes

  • Versatility for studying various biological processes from early development to immunity

These characteristics make Xenopus an excellent system for investigating the structure-function relationships of proteins like Spastin in a vertebrate context .

How conserved is Spastin between Xenopus laevis and humans?

While the search results don't provide specific sequence identity data for Spastin between species, we can infer significant conservation based on related AAA proteins. For instance, the AAA domain of Xenopus laevis katanin (another microtubule-severing protein in the same family as Spastin) shows approximately 93% identity to its human counterpart . Given this high degree of conservation in functional domains among AAA proteins, Xenopus Spastin likely retains core structural and catalytic properties similar to human Spastin.

This conservation allows researchers to use Xenopus Spastin as a model for understanding human disease mechanisms while taking advantage of the experimental benefits of the amphibian system. Important functional residues, such as those in the Walker A and B motifs required for ATP binding and hydrolysis, are typically invariant across species.

What expression systems are optimal for recombinant Xenopus laevis Spastin production?

Based on successful approaches with other Xenopus proteins, bacterial expression systems provide an effective platform for producing recombinant Xenopus laevis Spastin. The methodology typically involves:

  • Cloning the coding sequence into an expression vector (e.g., pGEX-2T) for production as a GST-fusion protein

  • Transforming the construct into E. coli BL21(DE3) cells

  • Growing cells in LB medium supplemented with appropriate antibiotics to OD600 0.5-0.6

  • Inducing protein expression with 0.1 mM IPTG at 37°C for 2-3 hours

  • Harvesting cells by centrifugation and storing at -80°C until purification

This approach has been successfully used for other Xenopus proteins such as synucleins, where the recombinant GST-fusion proteins were expressed with high yield and purity .

Table 1: Comparison of Expression Systems for Recombinant Xenopus Spastin Production

Expression SystemAdvantagesLimitationsOptimal ConditionsTypical Applications
E. coli BL21(DE3)High yield, simple culture, cost-effectiveLimited post-translational modificationsIPTG 0.1 mM, 37°C, 2-3 hoursStructural studies, activity assays
Insect cellsEukaryotic processing, proper foldingHigher cost, complex culture27°C, 48-72 hoursInteraction studies, functional assays
Xenopus oocytesNative environment, correct modificationsLow yield, labor-intensivemRNA injection, 18°C, 24-48 hoursIn vivo localization, electrophysiology
Cell-free systemRapid, avoids toxicity issuesExpensive, limited scale30°C, 2-4 hoursPreliminary activity screening

What purification strategies yield the highest purity of recombinant Spastin?

For GST-tagged recombinant Spastin, a multi-step purification process typically yields high purity:

  • Cell lysis in appropriate buffer (e.g., 25 mM MOPS pH 7, 150 mM NaCl, 1 mM PMSF, 1 mg/mL lysozyme)

  • Sonication followed by centrifugation (20,000 × g for 20 min) to clarify the lysate

  • Affinity chromatography using GSH-Sepharose Fast Flow according to manufacturer's instructions

  • Optional tag removal using thrombin followed by repurification on GSH-Sepharose

  • Recovery of purified protein in the unbound and wash fractions

  • Concentration by ultrafiltration with appropriate molecular weight cutoff filters (e.g., Vivaspin10K)

Protein concentration can be measured using the microBCA assay and spectrophotometric methods. This protocol has been successfully applied to other Xenopus proteins, resulting in high-yield and high-purity preparations .

How can I verify the structural integrity of purified recombinant Spastin?

Several biophysical techniques can assess the structural integrity of purified recombinant Spastin:

  • Circular Dichroism (CD) spectroscopy:

    • Record far-UV CD spectra (260-190 nm) using a spectropolarimeter with 0.1 cm cuvettes

    • Average multiple scans with buffer subtraction

    • Analyze secondary structure elements and compare with expected profiles

    • Observe changes in the presence of substrates or binding partners

  • Fluorescence spectroscopy:

    • Measure intrinsic fluorescence from aromatic residues (excitation at 270 nm)

    • Collect emission spectra between 280-500 nm with appropriate slit widths

    • Analyze spectral characteristics indicative of proper folding

  • Activity assays:

    • Measure ATPase activity through phosphate release or coupled enzyme assays

    • Perform microtubule-severing assays to confirm functional activity

These approaches have been successfully used for structural characterization of other Xenopus proteins like synucleins, where CD spectroscopy revealed their predominantly unfolded state with a transition to α-helical structure upon interaction with detergents like SDS .

What assays can effectively measure Spastin's microtubule-severing activity?

Spastin's primary function is microtubule severing, which can be assessed through several complementary approaches:

  • In vitro microtubule severing assays:

    • Polymerize fluorescently labeled microtubules from purified tubulin

    • Add purified recombinant Spastin and ATP

    • Monitor via time-lapse fluorescence microscopy

    • Quantify microtubule length distribution before and after treatment

  • Cell-based assays:

    • Express Xenopus Spastin constructs in cultured cells

    • Perform immunofluorescence to visualize the microtubule network

    • Quantify changes in microtubule density and organization

    • Compare effects of wild-type vs. mutant Spastin variants

  • ATPase activity correlations:

    • Measure ATP hydrolysis rates using colorimetric or fluorometric methods

    • Correlate ATPase activity with severing efficiency

    • Assess the effects of different mutations on coupled ATP hydrolysis and severing

When designing these assays, it's important to use appropriate controls, including ATPase-dead mutants and buffer-only treatments, to distinguish specific Spastin activity from background effects.

How can I design experiments to study Spastin's role in nuclear envelope reassembly?

Spastin contributes to nuclear envelope reassembly during anaphase, being recruited to the nuclear membrane by IST1 to promote microtubule severing and nuclear envelope sealing . Investigating this function requires specialized experimental designs:

  • Xenopus egg extract system:

    • Prepare cell-free extracts from Xenopus eggs

    • Add components to induce nuclear envelope assembly

    • Include or deplete Spastin to assess effects on reassembly

    • Monitor using fluorescently labeled nuclear envelope markers

  • Live cell imaging approaches:

    • Express fluorescently tagged Spastin in Xenopus cells

    • Perform time-lapse microscopy during mitosis

    • Co-label with nuclear envelope components

    • Track recruitment dynamics during anaphase

  • Structure-function analysis:

    • Create Spastin mutants affecting specific domains or interactions

    • Assess their ability to complement Spastin depletion

    • Focus on mutations affecting IST1 binding or ATPase activity

    • Compare wild-type and mutant proteins for localization and function

These approaches can provide mechanistic insights into how Spastin contributes to the critical process of nuclear envelope reformation following mitosis.

What are the key considerations for studying Spastin in Xenopus development and disease models?

When using Xenopus to investigate Spastin's developmental roles or model Hereditary Spastic Paraplegia:

  • Developmental expression analysis:

    • Perform stage-specific RT-PCR or in situ hybridization

    • Analyze tissue distribution during embryogenesis

    • Compare expression patterns with human developmental data

    • Correlate expression with developmental processes requiring microtubule remodeling

  • Loss-of-function approaches:

    • Design antisense morpholinos or CRISPR guides targeting Spastin

    • Inject at early embryonic stages

    • Assess developmental outcomes, particularly in neural tissues

    • Document phenotypes related to axonal development and maintenance

  • Disease-modeling strategies:

    • Introduce human disease-associated mutations

    • Analyze effects on neural development and function

    • Establish phenotypic assays relevant to Hereditary Spastic Paraplegia

    • Test potential therapeutic interventions

  • Integration with human data:

    • Compare Xenopus phenotypes with clinical manifestations

    • Validate findings across species boundaries

    • Identify conserved mechanisms underlying pathology

Xenopus offers significant advantages for modeling neurodevelopmental aspects of Spastin-related disorders due to its well-characterized neural development and accessibility for manipulation.

How do mutations in recombinant Spastin affect its ATPase activity?

Structure-function analysis of Spastin mutations provides insights into disease mechanisms and protein function:

Table 2: Impact of Key Mutations on Recombinant Spastin Activity

Mutation TypeLocationEffect on ATPase ActivityEffect on Microtubule SeveringRelevance
Walker A (K to A)ATP binding siteSevere reductionComplete lossPrevents ATP binding
Walker B (E to Q)ATP hydrolysis siteReduction with ATP binding retainedComplete lossAllows binding but blocks hydrolysis
MIT domainN-terminal regionMinimal effect on ATPaseAltered localizationAffects interactions with ESCRT-III
Disease-associatedVariousVariable (30-90% reduction)Variable impairmentDirect pathological relevance

When studying these mutations:

  • Compare enzyme kinetics (Km, Vmax) between wild-type and mutant proteins

  • Assess oligomerization status, as many AAA proteins function as hexamers

  • Correlate biochemical defects with cellular phenotypes

  • Consider allosteric effects of mutations outside catalytic sites

The type of mutation can dramatically influence Spastin's activity, with some affecting ATP binding, others affecting hydrolysis, and still others affecting substrate recognition or protein-protein interactions.

What approaches can be used to study Spastin interactions with binding partners?

Understanding Spastin's protein-protein interactions is crucial for elucidating its cellular functions:

  • Affinity purification techniques:

    • Use GST-tagged recombinant Spastin for pull-down assays

    • Perform co-immunoprecipitation with specific antibodies

    • Apply tandem affinity purification for complex isolation

    • Analyze interacting proteins by mass spectrometry

  • Direct binding assays:

    • Measure binding kinetics using surface plasmon resonance

    • Perform fluorescence-based interaction assays

    • Use isothermal titration calorimetry for thermodynamic parameters

    • Employ microscale thermophoresis for solution-based measurements

  • Functional validation:

    • Test if depletion of binding partners affects Spastin localization

    • Assess whether interactions are required for microtubule severing

    • Investigate co-localization in cellular contexts

    • Determine if disease mutations disrupt specific interactions

A particularly important interaction to study would be between Spastin and IST1, which is reported to recruit Spastin to both the midbody during cytokinesis and the nuclear membrane during anaphase .

How can chemical genetics approaches be applied to study Xenopus Spastin function?

Chemical genetics offers powerful tools for precise temporal control of protein function:

  • Engineered sensitivity approaches:

    • Create Spastin mutants with engineered cysteine residues in the active site

    • Design compounds that specifically target these engineered residues

    • Test for selective inhibition of the mutant but not wild-type protein

    • Apply in cellular or developmental contexts for temporal control

  • Small molecule inhibitor development:

    • Screen compound libraries for Spastin inhibitors

    • Characterize inhibition mechanisms (competitive, non-competitive)

    • Assess selectivity against other AAA proteins

    • Develop structure-activity relationships

  • Implementation strategies:

    • Use proximity-induced reactivity-based inhibitors similar to those developed for other AAA proteins

    • Create allele-specific inhibitors that target specific Spastin variants

    • Apply in Xenopus embryos to assess developmental functions

    • Combine with genetic approaches for comprehensive analysis

This approach has been successful with related AAA proteins like katanin, where compound specificity was achieved through non-covalent interactions that position the inhibitor near a reactive cysteine residue .

How can recombinant Spastin be used to study neurodevelopmental processes in Xenopus?

Xenopus embryos provide an excellent system for studying neurodevelopment:

  • Microinjection approaches:

    • Inject recombinant Spastin protein or mRNA into early embryos

    • Target specific blastomeres fated to become neural tissue

    • Assess effects on neural tube formation and axon outgrowth

    • Compare wild-type and mutant proteins for rescue experiments

  • Ex vivo applications:

    • Culture explants from neural tissues

    • Apply recombinant Spastin to study local effects on growth cones

    • Visualize microtubule dynamics in real-time

    • Investigate axon branching and pathfinding behaviors

  • Integration with signaling pathways:

    • Study interactions between Spastin and BMP/Wnt signaling

    • Examine effects on neural induction and patterning

    • Assess impact on dorsoventral axis formation

    • Investigate potential cross-regulation with other cytoskeletal regulators

These approaches allow researchers to connect Spastin's biochemical activities to its roles in neural development, providing insights into disease mechanisms.

What controls are essential when studying recombinant Xenopus Spastin activity?

Rigorous control experiments ensure valid interpretation of Spastin activity data:

  • Negative controls:

    • ATPase-dead Spastin mutants (Walker A or B mutations)

    • Heat-inactivated protein preparations

    • Buffer-only treatments

  • Positive controls:

    • Known microtubule-severing proteins (katanin or fidgetin)

    • Previously characterized Spastin preparations

    • Human Spastin for cross-species comparison

  • Specificity controls:

    • Other AAA proteins that don't sever microtubules

    • Tests on different cytoskeletal elements

    • Competition experiments with microtubule-stabilizing agents

  • System validation:

    • Verification of microtubule quality and stability

    • Confirmation of ATP availability and hydrolysis

    • Antibody validation using recombinant proteins

Proper controls are particularly important when working with enzymes like Spastin where background activity or spontaneous substrate changes can confound results.

How can emerging technologies advance our understanding of Xenopus Spastin?

Several cutting-edge approaches hold promise for Spastin research:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of Xenopus Spastin hexamers

    • Visualize conformational changes during ATP hydrolysis cycle

    • Analyze Spastin-microtubule complexes to understand severing mechanism

    • Compare structures of wild-type and disease-associated mutants

  • Advanced imaging techniques:

    • Apply super-resolution microscopy to track Spastin dynamics

    • Use optogenetic approaches for spatiotemporal control of Spastin activity

    • Implement live-cell FRET sensors to monitor Spastin conformational changes

    • Develop biosensors for microtubule severing events

  • Genome engineering:

    • Create CRISPR/Cas9-mediated Spastin mutant Xenopus lines

    • Generate knock-in fluorescent tags at endogenous loci

    • Produce tissue-specific conditional models

    • Design precise disease-associated mutations

These technologies will provide unprecedented insights into Spastin's structure, dynamics, and function in developing systems.

How can Xenopus Spastin studies contribute to therapeutic development for Hereditary Spastic Paraplegia?

Translating basic research to therapeutic applications requires strategic approaches:

  • Phenotypic screening platforms:

    • Develop Xenopus-based screens for compounds that rescue Spastin loss-of-function

    • Establish quantifiable readouts of microtubule dynamics or neural function

    • Screen for modulators of Spastin ATPase activity or stability

    • Identify compounds that promote alternative microtubule-severing pathways

  • Mechanism-based interventions:

    • Target specific steps in Spastin's catalytic cycle

    • Develop approaches to stabilize disease-associated mutants

    • Design peptides or small molecules to enhance remaining activity

    • Explore compensatory mechanisms involving related proteins

  • Preclinical validation:

    • Test candidate therapeutics in Xenopus disease models

    • Assess effects on neural development and function

    • Establish dosing parameters and safety profiles

    • Validate findings across multiple model systems

Xenopus offers advantages for therapeutic development including rapid development, external embryos accessible for manipulation and observation, and conservation of key disease-related pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.