Recombinant Xenopus laevis Sterol regulatory element-binding protein 2 (srebf2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
srebf2; Sterol regulatory element-binding protein 2; SREBP-2; Sterol regulatory element-binding transcription factor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
METLTELGDELTLGDIDEMLQFVSNQVGEFPDLFEEQLCQSYQGNNAMDTTLPKAYNQAA QQPYTTSAPQPQLLPVKAPPQATPQRTAPLLQPRPVVQTSPQPQLQQQTVMLTPNFSTAP QTRIIQQPLIYQNAATTSFQVLQPPVQSLMTTQQMQPVTIQQQVQTVQAQRVLTQAANGT IQTLTPATVQTVTPHVQQVPVLVQPQIIKTESLVLTAVKADGSPVMTAVQNPAITTLAGT LQTTALQVPTLMGSNGTILTTMPVMMGQEKMPIKQVPGSLKLAEVPKEGERRTTHNIIEK RYRSSINDKIMELKDLVMGTDAKMHKSGVLKKAIDYIKYLQQVNQKLRQENMALKLANQK NKYLKGIDLSSLVDTSIGMKIDEFNQNALMMSPPASDSGSPAVFSPYSVDSEPGSPLLDD EKVKDEPDSPTGLGMMDRSRMLL
Uniprot No.

Target Background

Function

Recombinant Xenopus laevis Sterol Regulatory Element-Binding Protein 2 (SREBF2): A precursor of the transcription factor form (processed SREBP-2), embedded in the endoplasmic reticulum membrane. Low sterol concentrations trigger processing, releasing the transcription factor form which translocates to the nucleus and activates transcription of cholesterol biosynthesis genes. A key transcription factor regulating cholesterol biosynthesis gene expression, it binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). It exhibits dual sequence specificity, binding to both an E-box motif (5'-ATCACGTGA-3') and SRE-1, regulating transcription of genes within the cholesterol synthesis pathway.

Database Links

KEGG: xla:443980

UniGene: Xl.34538

Protein Families
SREBP family
Subcellular Location
[Sterol regulatory element-binding protein 2]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 2]: Nucleus.

Q&A

Intermediate Research Questions

  • How do researchers perform SREBF2 knockdown or knockout studies in Xenopus laevis?

    For SREBF2 knockdown/knockout studies in Xenopus laevis, researchers employ several approaches:

    • Morpholino oligonucleotides (MOs): Designed to block SREBF2 mRNA translation or splicing, injected into 1-2 cell stage embryos

    • CRISPR/Cas9 gene editing: Used to create F0 mosaic mutants or stable transgenic lines

      • sgRNAs targeting conserved domains of SREBF2

      • Cas9 mRNA or protein co-injected with sgRNAs

      • Mutation verification by T7 endonuclease assay or sequencing

    • Dominant negative constructs: Overexpression of truncated SREBF2 versions lacking activation domains

    • Pharmacological inhibition: Using compounds that inhibit SREBP processing

    Due to Xenopus laevis' allotetraploid genome, researchers often must target both homeologs (L and S copies) of SREBF2 to achieve complete loss of function .

  • What are the key differences in SREBF2 regulation between Xenopus laevis and mammalian models?

    Several important differences exist in SREBF2 regulation between Xenopus and mammals:

    FeatureXenopus laevisMammals
    Genome structureAllotetraploid with two gene copies (L and S)Diploid (single copy)
    Developmental dynamicsRapid early development with maternal SREBF2 storesSlower development with less maternal contribution
    Tissue-specific expressionHigher expression in developing neural crest and brainBroader expression with liver prominence
    Temperature sensitivityFunctions at lower temperatures (16-24°C)Optimized for 37°C
    Metabolic rateLower metabolic rate impacts sterol homeostasis timingHigher metabolic rate with faster responses

    These differences must be considered when translating findings between species. Additionally, Xenopus embryos can survive longer without proper cholesterol synthesis, enabling the study of long-term consequences of SREBF2 disruption .

  • How is SREBF2 involved in Xenopus laevis development and tissue differentiation?

    SREBF2 plays several critical roles during Xenopus development:

    • Neural crest development: SREBF2 expression is detected in neural crest cells, suggesting a role in their specification or migration

    • Brain development: Regulates cholesterol biosynthesis required for proper neuronal development

    • Cardiovascular development: May influence lipid composition of developing heart tissues

    • Metabolic programming: Sets up early cholesterol homeostasis important for membrane formation

    • Metamorphosis: Potential role in lipid metabolism remodeling during this dramatic transition

    SREBF2 functions appear to be partially separable from its role in cholesterol homeostasis, suggesting additional developmental signaling functions. Its expression patterns dynamically change throughout development, with maternal stores present in oocytes and zygotic expression beginning during gastrulation .

  • What techniques are used to measure SREBF2 activation and nuclear translocation in Xenopus systems?

    Researchers employ several techniques to monitor SREBF2 activation and nuclear translocation in Xenopus:

    • Subcellular fractionation: Separation of nuclear and cytoplasmic/membrane fractions followed by Western blotting

    • Immunofluorescence microscopy: Using anti-SREBF2 antibodies to visualize localization in fixed embryos or explants

    • Reporter gene assays: Using SRE-driven luciferase constructs to measure transcriptional activity

    • ChIP-seq: To identify genome-wide binding patterns upon activation

    • Phosphorylation analysis: Since SREBF2 activation involves phosphorylation events

    • Co-immunoprecipitation: To detect interactions with regulatory partners like SCAP

    In Xenopus embryos, these analyses must account for tissue heterogeneity, often requiring dissection of specific regions or using tissue-specific markers .

Advanced Research Questions

  • How do researchers resolve the challenges of studying SREBF2 in the allotetraploid genome of Xenopus laevis?

    The allotetraploid nature of Xenopus laevis presents unique challenges for SREBF2 research. Methodological approaches include:

    • Subgenome-specific primers/probes: Designed to distinguish between L and S homeologs of SREBF2

    • CRISPR multiplexing: Simultaneous targeting of all SREBF2 copies using multiple sgRNAs

    • Homeolog-specific antibodies: Where possible, to distinguish protein products

    • RNA-seq with allele-aware alignment: To quantify relative expression of each homeolog

    • Comparative studies with X. tropicalis: Which has a simpler diploid genome

    • Gene synteny analysis: To confirm orthology relationships

    Researchers must establish whether functional redundancy exists between homeologs or if they have undergone subfunctionalization. Studies show that approximately 56% of genes in X. laevis have retained both L and S copies, with the remainder having lost one copy, typically from the S subgenome .

  • What are the technical considerations for ChIP-seq experiments targeting SREBF2 in Xenopus models?

    ChIP-seq experiments for SREBF2 in Xenopus require specific technical considerations:

    • Antibody validation: Confirm specificity for Xenopus SREBF2 versus other SREBP family members

    • Cross-reactivity testing: Ensure antibodies don't cross-react between L and S homeologs if differential analysis is desired

    • Sample preparation: Typically requires 1000-5000 embryos or embryo parts per experiment

    • Fixation protocols: Optimized for Xenopus embryonic tissues (1-2% formaldehyde, 10-15 minutes)

    • Sonication parameters: Adjusted for yolk-rich Xenopus tissues

    • Bioinformatic pipeline: Must account for the allotetraploid genome

      • GLITR program can be used for peak identification (as used for SREBP-2 in other species)

      • Peak-discovery with appropriate false discovery rate calculations (≤1.5%)

    • Motif analysis: Should include MEME analysis to identify Xenopus-specific binding motifs

    When properly executed, ChIP-seq can identify direct SREBF2 targets involved in cholesterol metabolism and potentially novel developmental pathways .

  • How does SREBF2 interact with other transcription factors in regulating cholesterol metabolism in Xenopus?

    SREBF2 functions within a complex regulatory network in Xenopus, interacting with several other factors:

    • LXR (Liver X Receptor): Evidence from mammalian studies suggests SREBF2 activity influences LXR-dependent transcription by regulating endogenous sterol ligand production

    • SREBF1: Coordinates with SREBF2, with SREBF1 primarily regulating fatty acid synthesis while SREBF2 focuses on cholesterol biosynthesis

    • SP1: Potential co-regulation at promoters containing both SRE and SP1 binding sites

    • NF-Y: Cooperates at promoters containing CCAAT boxes near SREs

    • USF (Upstream Stimulatory Factor): May compete for E-box binding sites

    Interestingly, studies in mammalian systems have shown that SREBP-2 is required for normal expression of SREBP-1c, suggesting hierarchical regulation that may be conserved in Xenopus . This interaction network likely evolved to coordinate different aspects of lipid metabolism.

  • What are the methodological approaches to study SREBF2 role in lipid metabolism during Xenopus metamorphosis?

    Studying SREBF2 during Xenopus metamorphosis requires specialized approaches:

    • Stage-specific analysis: Collection of tissues at precise Nieuwkoop and Faber stages before, during, and after metamorphosis

    • Hormone manipulation: Using T3/T4 thyroid hormones to induce precocious metamorphosis

    • Metamorphic organ culture: Ex vivo culture systems to study organ-specific effects

    • Transgenic approaches: Using heat-shock or hormone-inducible promoters to control SREBF2 expression during metamorphosis

    • Metabolomic analysis: LC-MS/MS profiling of lipid species throughout metamorphosis

    • Isotope labeling: Tracking cholesterol synthesis rates using deuterated water or 13C-acetate

    • Temporal inhibition: Using chemical inhibitors of SREBP processing only during metamorphic periods

    These approaches help disentangle the complex metabolic remodeling that occurs during this dramatic life stage transition, when many organ systems undergo substantial reconstruction requiring extensive membrane synthesis and remodeling .

  • How can CRISPR/Cas9 technology be optimized for studying SREBF2 function in Xenopus laevis?

    Optimizing CRISPR/Cas9 for SREBF2 studies in Xenopus laevis involves several specific considerations:

    • Target site selection:

      • Design sgRNAs targeting conserved functional domains (bHLH domain)

      • Target sites must be identical in both L and S homeologs for simultaneous knockout

      • Avoid sites with potential off-targets in the allotetraploid genome

    • Delivery methods:

      • Microinjection of Cas9 protein (rather than mRNA) with sgRNAs for immediate activity

      • One-cell stage injection for global effects or targeted blastomere injection for tissue-specific studies

      • Concentrations: typically 1-2 ng Cas9 protein with 50-100 pg sgRNA

    • Validation strategies:

      • T7 endonuclease assay modified for detecting mutations in homeologs

      • Deep sequencing to quantify editing efficiency in each homeolog

      • Protein verification using Western blotting

    • Functional analysis in F0 generation:

      • Embryos are typically mosaic, requiring careful phenotypic analysis

      • Use of appropriate controls including mismatched sgRNAs

    • Germline transmission:

      • Raising F0 to adulthood for breeding stable lines

      • Generation time optimization: reduced to 8 months for X. laevis (vs 3 months for X. tropicalis)

  • What approaches can resolve contradictory data regarding SREBF2 function between different model systems?

    When encountering contradictory results between Xenopus and other model systems, researchers can employ several resolution strategies:

    • Comparative functional studies: Side-by-side analysis of SREBF2 from different species in the same experimental system

      • Express human SREBF2 in Xenopus embryos and vice versa

    • Domain swap experiments: Create chimeric proteins combining domains from different species to identify functionally divergent regions

    • Cross-species rescue experiments: Test if SREBF2 from one species can rescue defects in another

    • Evolutionary analysis: Phylogenetic comparisons to identify species-specific adaptations

    • Biochemical parameter optimization: Adjust experimental conditions (temperature, pH, cofactors) to account for species-specific biochemical requirements

    • Tissue-specific analysis: Compare function in homologous tissues rather than whole organisms

    • Technological standardization: Use identical methodologies where possible, accounting for species-specific requirements

    These approaches help distinguish genuine biological differences from methodological artifacts .

  • How can researchers integrate omics approaches to understand the full spectrum of SREBF2 function in Xenopus?

    An integrated omics approach to SREBF2 function in Xenopus involves:

    • Multi-level omics integration:

      • ChIP-seq to identify direct binding targets

      • RNA-seq to measure transcriptional effects

      • Proteomics to assess protein-level changes

      • Lipidomics to characterize metabolic outcomes

      • Metabolomics to identify broader metabolic network effects

    • Temporal analysis:

      • Time-course experiments capturing dynamic changes

      • Stage-specific sampling during development

    • Spatial resolution:

      • Tissue-specific or single-cell RNA-seq

      • Spatial transcriptomics for regional mapping

    • Network analysis:

      • Gene regulatory network reconstruction

      • Pathway enrichment analysis

      • Protein-protein interaction mapping

    • Systems biology modeling:

      • Predictive models of SREBF2-dependent metabolic fluxes

      • Integration with existing developmental models

    This comprehensive approach can reveal both conserved and species-specific aspects of SREBF2 function, connecting its roles in metabolism and development .

Notes for Researchers

When working with recombinant Xenopus laevis SREBF2, consider these practical recommendations:

  • Store lyophilized protein at -20°C/-80°C with aliquoting to avoid freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage

  • The protein functions optimally in Tris/PBS-based buffer at pH 8.0

  • For antibody-based applications, validate antibodies specifically for Xenopus SREBF2

  • When comparing with mammalian SREBP-2, account for differences in protein processing and stability at different temperatures

  • Consider both X. laevis and X. tropicalis models for complementary advantages in genetic studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.