Recombinant Xenopus laevis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial (sdhd-b)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
sdhd-b; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial; CybS-B; Succinate dehydrogenase complex subunit D-B; Succinate-ubiquinone oxidoreductase cytochrome b small subunit B; Succinate-ubiquinone reductase membrane anchor subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-152
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
sdhd-b
Target Protein Sequence
LLIRPLPCLSQDLHMVQTSQIHTSPNHHAGSKAASMHWTGERALSVALLGLLPAAYLYPG
AAMDYSLAAALTLHGHWGLGQVVTDYVHGETKIKMANTSLFALSALTFAGLCYFNYHDVG
ICKAVAMLWSL
Uniprot No.
Target Background
Function
Function: Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. It facilitates electron transfer from succinate to ubiquinone (coenzyme Q).
Database Links
KEGG: xla:496372
UniGene: Xl.24286
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
