Recombinant Xenopus laevis Sulfhydryl oxidase 2 (qsox2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
qsox2; qscn6l1; Sulfhydryl oxidase 2; Quiescin Q6-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-661
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
ETLYGPEDSVTILNKESVARAVFNSSSAWLLEFYSSWCGHCINYAPTWKALARDVRDWEP AIKIGVLDCAEEDNYGACKDFGVTLYPTFRFFKAFTKEFTQGENYKAVGDREIQTVRQVI IDFLQTSPAESKPQAWPSLEPISSSEISSLLTPKQSHYTAIIFESEESYEGREVILDLIQ YSNIVVRRALPSDKPILEKLGIGSVPSCYLIQPNGLHGLINDVKSIRSQLSLHLKALSNV RKLLPSETAHSGLSKGVQQEDTTMNQFDRSKLYMTDLESGLHYILRAELANHHTLEGEKL KTFKDFVTILYKLFPGRPHVMKLLETLQEWLVSMPLDTIPYDAILDLVNNKMRISGIFLT NHTQWVGCRGSKSNLRGYPCSLWKLFHSLTVQAAVKPDALANTAFEAEPRAVLQTMRRYI REFFGCRECAKHFEAMAKETVDSVKTPDQAILWLWRKHNVVNNRLSGAPSEDPKFPKVQW PTSDLCSACHSQTGGVHSWNEDEVLAFLKRYYGNQEISLEFADPRKDLSEAATDNGNKEP HFTKKPQERDYVKKQNPQFLDKLVQKKPEKSLDSEAAESSQSVSFLGIGFSNIDMSLCVI LYVTSSLFLMIMFFFFRFRSKRWKVRYNRPFV
Uniprot No.

Target Background

Function
This recombinant Xenopus laevis Sulfhydryl oxidase 2 (qsox2) catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides, concomitantly reducing oxygen to hydrogen peroxide. It likely contributes to disulfide bond formation in various secreted proteins.
Database Links

KEGG: xla:447270

UniGene: Xl.46319

Protein Families
Quiescin-sulfhydryl oxidase (QSOX) family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is QSOX2 and what are its primary functions in Xenopus laevis?

QSOX2 (Quiescin Sulfhydryl Oxidase 2) is an enzyme associated with oxidative protein folding that can be directly secreted into the extracellular space . In cellular contexts, it appears to be involved in cell cycle regulation, with periodic expression during different cell cycle phases . Research suggests QSOX2 may have roles in meiosis progression in amphibians, potentially through cellular redox systems. The enzyme catalyzes the oxidation of sulfhydryl groups during protein folding, contributing to the formation of disulfide bonds in proteins.

How is QSOX2 expressed during the Xenopus cell cycle?

QSOX2 expression changes throughout the cell cycle phases in a periodic pattern. Research indicates that QSOX2 is expressed periodically during the cell cycle and is directly regulated by E2F1, a transcription factor known to control genes involved in cell cycle progression . In Xenopus oocytes specifically, research has shown that H₂S (which may interact with sulfhydryl oxidase systems) natural production is decreased in oocytes arrested in metaphase II compared to prophase I blocked oocytes . This suggests a potential relationship between redox systems (which would include QSOX2) and meiotic cell cycle control in Xenopus.

What techniques are commonly used to study QSOX2 in Xenopus laevis?

Several established techniques have proven effective for QSOX2 research:

  • Real-time quantitative PCR (qPCR) for gene expression analysis

  • Immunohistochemistry (IHC) for protein localization in tissues

  • Western blot analysis (WB) for protein expression levels and verification

  • Enzyme-linked immunosorbent assays (ELISA) for measuring secreted protein in serum or culture media

  • RNA interference techniques for gene knockdown studies

  • Microarray analysis for transcriptomic profiling across developmental stages

  • Chromatin immunoprecipitation assay (ChIP) for studying transcriptional regulation

  • Dual-Luciferase reporter assay for confirming direct transcriptional control

How can recombinant Xenopus laevis QSOX2 be produced effectively?

While specific details for Xenopus QSOX2 production aren't provided in the search results, effective production would likely involve:

  • Gene cloning: Isolating the Xenopus laevis QSOX2 cDNA sequence from appropriate tissue sources

  • Expression vector design: Constructing vectors with appropriate promoters and purification tags

  • Host selection: Using eukaryotic expression systems (likely insect or mammalian cells) to ensure proper folding and post-translational modifications

  • Purification optimization: Employing affinity chromatography methods while maintaining appropriate redox conditions to preserve enzyme activity

  • Activity validation: Confirming enzymatic function through sulfhydryl oxidase activity assays

Given QSOX2's role in oxidative protein folding, special attention must be paid to maintaining the appropriate redox environment during purification to preserve functional integrity.

What is the relationship between QSOX2 and cell cycle regulation in Xenopus laevis?

QSOX2 exhibits a complex relationship with cell cycle regulation. Research has established that QSOX2 is expressed periodically during the cell cycle and is directly regulated by the E2F1 transcription factor . Knockdown studies have demonstrated that QSOX2 silencing results in:

  • Accumulation of cells in G1 phase

  • Decreased frequencies of cells in S and G2/M phases

  • Significant increases in apoptosis

  • Reduced expression of cell division-related genes (CENPF and NUSAP1)

  • Downregulation of Wnt pathway activators (PRRX2 and Nuc-β-catenin)

In Xenopus oocytes specifically, the regulation of meiosis involves complex redox signaling. Studies show that H₂S metabolism affects meiosis resumption, with H₂S production decreased in metaphase II-arrested oocytes compared to prophase I-blocked oocytes . The MPF (M-phase promoting factor) activation, which triggers meiotic resumption through Cdc25c phosphatase, may be influenced by redox systems including sulfhydryl oxidases like QSOX2 .

How does QSOX2 interact with cellular redox systems during Xenopus development?

While direct evidence of QSOX2 interactions with other redox components in Xenopus is limited, we can draw inferences from available research. In Xenopus laevis oocytes, studies have shown that:

  • Hydrogen sulfide (H₂S) signaling affects meiosis resumption

  • This process involves reactive oxygen species (ROS) production

  • Meiotic progression shows sensitivity to superoxide dismutase and catalase

As QSOX2 participates in oxidative processes through its sulfhydryl oxidase activity, it likely forms part of this redox network. During protein folding, QSOX2 catalyzes disulfide bond formation, generating hydrogen peroxide as a byproduct. This H₂O₂ production could influence local redox environments and potentially interact with other signaling pathways during development.

What experimental approaches are most effective for studying QSOX2 function in Xenopus oocytes?

The Xenopus model offers unique advantages for studying QSOX2 function. Based on the research methodologies described, effective approaches include:

  • Single-cell analysis techniques: Taking advantage of the large size of Xenopus oocytes for studying cell cycle transitions at the single-cell level

  • Protein synthesis monitoring: Examining how QSOX2 affects protein synthesis during meiosis resumption

  • MPF activation pathway analysis: Investigating QSOX2's potential influence on the MPF auto-amplification loop and Cdc25C phosphatase activity

  • MAPK/Erk cascade examination: Studying potential interactions between QSOX2 and the MAPK/Erk signaling pathways essential for proper meiotic maturation

  • Redox manipulation experiments: Using H₂S donors (like NaHS) or inhibitors to manipulate redox environments while monitoring QSOX2 expression and activity

  • Knockdown studies: Using morpholinos or CRISPR-Cas9 to create QSOX2-deficient oocytes and assess phenotypic consequences

These approaches leverage Xenopus oocytes' experimental tractability while enabling detailed mechanistic studies of QSOX2 function.

How can differential expression of QSOX2 be accurately quantified across Xenopus developmental stages?

Accurate quantification of QSOX2 expression across developmental stages requires robust methodological approaches. Based on transcriptomic studies in Xenopus laevis, effective strategies include:

  • Microarray analysis: Using platforms like Affymetrix microarrays to assess transcriptome profiles across developmental stages (as demonstrated in the study examining inner ear development across larval stages 50 and 56, and post-metamorphic juvenile stage)

  • Differential expression analysis: Implementing pairwise comparisons between developmental stages with appropriate statistical filters (q-value ≤ 0.01; fold change ≥ 1.5) to identify significant changes

  • Bioinformatic validation: Applying techniques such as hierarchical clustering to verify stage-specific expression patterns

  • Protein-level verification: Confirming transcriptomic findings with protein quantification via western blotting and ELISA

  • Statistical rigor: Employing appropriate statistical methods, including Student's t-tests for comparing two groups, Spearman correlation for relationship analyses, and proper multiple testing corrections

These complementary approaches provide comprehensive understanding of QSOX2 expression dynamics throughout development.

What is the relationship between QSOX2 and E2F1 in transcriptional regulation?

Research has established that QSOX2 is directly regulated by E2F1 in the cell cycle . This relationship has been confirmed through:

  • Chromatin immunoprecipitation (ChIP) assays: Demonstrating direct binding of E2F1 to the QSOX2 promoter region

  • Dual-Luciferase reporter assays: Confirming functional regulation of QSOX2 expression by E2F1

  • Cell cycle analysis: Showing QSOX2 expression patterns consistent with E2F1-regulated genes

E2F1 is a pivotal transcription factor that controls the expression of many cell cycle-regulated genes, particularly those involved in the G1/S transition. The direct regulation of QSOX2 by E2F1 places it within a network of cell cycle-controlled genes and suggests its importance in proliferation-related processes .

This regulatory relationship explains why QSOX2 shows periodic expression during the cell cycle and suggests potential therapeutic approaches targeting this pathway in situations where QSOX2 is dysregulated.

What is the potential of QSOX2 as a biomarker in experimental models?

QSOX2 demonstrates significant potential as a biomarker based on several key characteristics:

  • Secretion properties: QSOX2 can be directly secreted into extracellular space, making it detectable in serum samples

  • Correlation with cell proliferation: Studies show that QSOX2 levels reflect cell proliferation status, with levels decreasing after anti-cancer therapy and increasing with disease progression

  • Quantifiable presence in bodily fluids: QSOX2 can be reliably measured in serum using ELISA techniques, with demonstrated diagnostic potential (AUC = 0.7769, specificity = 0.636, sensitivity = 0.818)

  • Response to treatment: In both in vitro and in vivo models, intracellular and extracellular QSOX2 levels significantly decreased after cisplatin treatment, indicating sensitivity to therapeutic intervention

  • Clinical correlation: Patient studies have shown that QSOX2 levels decreased after successful treatment (partial response cases), remained stable in stable disease, and increased in progressive disease cases

These properties make QSOX2 potentially valuable as a biomarker in Xenopus models studying cell proliferation, development, and response to experimental interventions.

How does recombinant QSOX2 compare functionally to native QSOX2 in Xenopus systems?

While the search results don't directly address functional comparisons between recombinant and native QSOX2 in Xenopus, several methodological considerations would be important for such comparisons:

  • Enzymatic activity assessment: Comparing sulfhydryl oxidase activity using standardized substrates

  • Post-translational modification analysis: Evaluating differences in glycosylation or other modifications that might affect function

  • Protein stability measurements: Determining thermal stability and resistance to degradation

  • Cellular localization studies: Confirming proper trafficking of recombinant protein compared to native counterpart

  • Interaction partner verification: Identifying whether recombinant QSOX2 maintains the same protein-protein interactions

For valid functional comparisons, recombinant QSOX2 production should prioritize maintaining native-like redox environments during expression and purification to preserve catalytic activity and structural integrity.

What are the optimal methods for studying QSOX2 involvement in the Wnt signaling pathway?

Research indicates that QSOX2 affects Wnt pathway activators, including PRRX2 and nuclear β-catenin . To study this relationship in Xenopus, the following methods would be optimal:

  • Genetic manipulation approaches:

    • QSOX2 knockdown via morpholinos or CRISPR-Cas9

    • QSOX2 overexpression through mRNA injection

    • Creation of dominant-negative QSOX2 constructs

  • Signaling pathway analysis:

    • Western blot analysis of Wnt pathway components following QSOX2 manipulation

    • Reporter assays using TOPFlash or similar Wnt-responsive reporters

    • Immunofluorescence to track β-catenin nuclear localization

  • Developmental phenotype assessment:

    • Analysis of axis formation and other Wnt-dependent developmental processes

    • Rescue experiments combining QSOX2 manipulation with Wnt pathway modulation

  • Protein interaction studies:

    • Co-immunoprecipitation to identify direct interactions with Wnt pathway components

    • Proximity ligation assays to detect protein-protein interactions in situ

These approaches would provide comprehensive understanding of how QSOX2 interfaces with the Wnt signaling pathway in Xenopus development and cellular processes.

What are the critical factors for maintaining QSOX2 enzymatic activity during recombinant production?

Maintaining enzymatic activity of recombinant QSOX2 requires attention to several critical factors:

  • Expression system selection: Eukaryotic systems (particularly insect or mammalian cells) are likely preferable to bacterial systems to ensure proper folding and post-translational modifications

  • Redox environment control: As a sulfhydryl oxidase, QSOX2's active site and structural disulfide bonds are sensitive to redox conditions, requiring careful buffer optimization during purification

  • Temperature considerations: Purification at lower temperatures may help preserve enzymatic activity by reducing thermal denaturation risk

  • Protease inhibition: Including appropriate protease inhibitors throughout the purification process to prevent degradation

  • Storage optimization: Determining ideal storage conditions (buffer composition, pH, temperature, additives) to maintain long-term stability

  • Activity validation: Implementing reliable sulfhydryl oxidase activity assays to confirm functionality of the recombinant protein

How can RNA-seq data be effectively analyzed to study QSOX2 expression networks?

Effective RNA-seq analysis for studying QSOX2 expression networks should follow these methodological approaches:

  • Quality filtering and normalization: Implementing appropriate quality thresholds (q-value ≤ 0.01; fold change ≥ 1.5) to focus on biologically significant changes

  • Developmental stage comparisons: Conducting pairwise comparisons between different developmental stages to identify stage-specific expression patterns

  • Co-expression network analysis: Identifying genes with similar expression patterns to QSOX2 across conditions

  • Pathway enrichment analysis: Utilizing tools like KEGG pathway analysis to identify biological processes associated with QSOX2 expression

  • Transcription factor binding site analysis: Examining promoter regions of co-expressed genes for common regulatory elements

  • Validation approaches: Confirming key findings with qPCR, protein expression analysis, and functional studies

This systematic approach would provide comprehensive understanding of QSOX2's position within broader gene expression networks during Xenopus development.

What experimental design considerations are important when studying QSOX2 in Xenopus oocyte maturation?

When investigating QSOX2 in Xenopus oocyte maturation, several experimental design considerations are crucial:

  • Oocyte staging: Carefully selecting and verifying oocyte stages (e.g., prophase I versus metaphase II) based on established criteria

  • Maturation induction: Using standardized methods for inducing maturation, such as progesterone treatment at defined concentrations

  • Control selection: Including appropriate controls to distinguish specific QSOX2 effects from general redox perturbations

  • Time course analysis: Implementing temporal sampling to capture dynamic changes in QSOX2 expression and activity during maturation

  • Molecular indicators: Monitoring key molecular markers of maturation, including:

    • MPF activation (Cdk1/CyclinB complex)

    • Cdc25C phosphatase activity

    • MAPK/Erk activation status

  • Statistical rigor: Employing appropriate statistical methods and sample sizes to ensure reproducibility

These considerations leverage the unique advantages of the Xenopus oocyte system, which allows for study of cell cycle transitions at the single-cell level .

How should contradictory results in QSOX2 functional studies be interpreted?

When encountering contradictory results in QSOX2 studies, researchers should consider:

  • Model system differences: Effects may vary between cell types, developmental stages, or species. For example, research suggests H₂S signaling in Xenopus oocytes differs from other species, with no apoptosis promotion observed

  • Temporal considerations: QSOX2 functions periodically during the cell cycle, so timing of experiments may yield different results

  • Dosage effects: QSOX2 overexpression versus knockdown may reveal different aspects of its function

  • Context dependency: The cellular environment, including redox status and presence of interaction partners, may influence QSOX2 activity

  • Technical variables: Differences in recombinant protein preparation, experimental conditions, or measurement techniques may explain contradictory findings

  • Statistical analysis approach: Applying appropriate statistical methods such as Student's t-tests for comparing groups, with consideration of potential confounding variables

Careful consideration of these factors allows for nuanced interpretation of apparently contradictory results.

What statistical approaches are most appropriate for analyzing QSOX2 expression data?

Based on the research methodologies described, appropriate statistical approaches include:

  • For comparing two groups: Two-sided paired or unpaired Student's t-test, depending on experimental design

  • For correlation analysis: Spearman correlation coefficient, particularly useful for analyzing relationships between protein expression patterns

  • For survival analysis: Kaplan-Meier analysis when examining prognostic value

  • For non-parametric comparisons: Mann-Whitney U test for comparing independent groups, especially for immunohistochemistry scores

  • For categorical variable analysis: Chi-square test for examining correlations between gene expression and clinicopathological characteristics

  • For diagnostic potential assessment: Receiver operating characteristic (ROC) analysis, with area under curve (AUC) calculation

  • For differential expression analysis: Implementation of appropriate false discovery rate controls and fold change thresholds (q-value ≤ 0.01; fold change ≥ 1.5)

Statistical significance should generally be defined as P < 0.05, with appropriate software tools like SPSS for analysis implementation .

How can transcriptomic and proteomic data be integrated to better understand QSOX2 function?

Effective integration of transcriptomic and proteomic data requires systematic methodological approaches:

  • Temporal alignment: Collecting RNA and protein samples at matched timepoints to enable direct correlation analysis

  • Multi-omic clustering: Implementing hierarchical clustering of both transcriptomic and proteomic datasets to identify coordinated expression patterns

  • Pathway mapping: Utilizing tools like KEGG pathway analysis to place QSOX2 and related genes within functional networks

  • Correlation analysis: Calculating statistical correlations between mRNA and protein expression levels using methods like Spearman correlation

  • Functional validation: Following up on key findings with targeted experimental approaches:

    • Verification of protein-level changes following transcriptional alterations

    • Biochemical assays to confirm predicted functional relationships

    • Cellular assays to assess biological significance

  • Visualization techniques: Employing tools like heatmaps showing hierarchical clustering of expression differences to effectively communicate integrated findings

This integrative approach provides more comprehensive understanding than either methodology alone.

What are the key considerations when designing QSOX2 knockdown experiments in Xenopus?

When designing QSOX2 knockdown experiments in Xenopus, researchers should consider:

  • Knockdown method selection:

    • Antisense morpholinos for transient knockdown

    • CRISPR-Cas9 for targeted gene editing

    • siRNA approaches for cell culture studies

  • Validation strategies:

    • qPCR to verify reduction in QSOX2 mRNA levels

    • Western blot to confirm protein level decreases

    • Activity assays to assess functional consequences

  • Control design:

    • Scrambled morpholinos/siRNAs as negative controls

    • Rescue experiments with QSOX2 mRNA to confirm specificity

  • Phenotypic assessment:

    • Cell cycle analysis to examine effects on progression through G1, S, and G2/M phases

    • Apoptosis measurement to detect potential increases in cell death

    • Developmental milestone monitoring in embryo studies

  • Molecular pathway analysis:

    • Assessment of cell division-related genes (e.g., CENPF and NUSAP1)

    • Evaluation of Wnt pathway components (e.g., PRRX2 and Nuc-β-catenin)

    • Examination of MPF activation and MAPK/Erk signaling

These considerations ensure generation of reliable, interpretable data regarding QSOX2 function.

What are the most promising future research directions for QSOX2 in Xenopus models?

Several promising research directions emerge from current knowledge about QSOX2:

  • Developmental biology applications: Investigating QSOX2's role throughout Xenopus development, particularly during transitions between developmental stages that show differential gene expression

  • Redox signaling networks: Exploring QSOX2's position within broader redox regulation networks, building on findings about H₂S signaling in meiosis regulation

  • Cell cycle regulation mechanisms: Further characterizing QSOX2's periodic expression and relationship with E2F1 regulation in the context of amphibian development

  • Wnt pathway interactions: Deeper investigation of how QSOX2 affects Wnt signaling components, potentially influencing developmental patterning

  • Biomarker development: Evaluating QSOX2 as a biomarker in Xenopus disease models, following its demonstrated potential in cancer monitoring

  • Comparative biology approaches: Systematic comparison of QSOX2 function across species to identify conserved and divergent aspects

These directions leverage Xenopus as a powerful model system while advancing understanding of fundamental biological processes.

How can recent technological advances improve QSOX2 research methodologies?

Recent technological advances offer significant opportunities for QSOX2 research:

  • Single-cell transcriptomics: Enabling analysis of QSOX2 expression at unprecedented cellular resolution across developmental stages

  • CRISPR-Cas9 gene editing: Facilitating precise genetic manipulation to create QSOX2 knockout or knock-in Xenopus models

  • Advanced imaging techniques: Allowing real-time visualization of QSOX2 localization and activity in living cells and tissues

  • Cryo-electron microscopy: Providing structural insights into QSOX2 protein complexes at near-atomic resolution

  • Mass spectrometry advances: Enabling comprehensive analysis of post-translational modifications and interaction partners

  • Microfluidic systems: Facilitating high-throughput analysis of QSOX2 enzymatic activity under various conditions

  • Computational modeling: Predicting QSOX2 functional interactions within cellular networks based on multi-omic data integration

These technologies can address current knowledge gaps while generating new hypotheses about QSOX2 function in Xenopus development and cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.