Recombinant Xenopus laevis T-cell leukemia translocation-altered gene protein homolog (tcta)

Shipped with Ice Packs
In Stock

Description

Role in Osteoclastogenesis

Human TCTA is critical for osteoclast formation, a process regulated by receptor activator of NF-κB ligand (RANKL) and macrophage colony-stimulating factor (M-CSF). TCTA facilitates cellular fusion during osteoclast maturation, as demonstrated by peptide inhibition studies . A synthetic 29-mer peptide derived from TCTA’s extracellular domain (containing the inhibitory motif GQN) suppresses osteoclastogenesis in human monocytes and mature osteoclasts .

Protein Interactions

Human TCTA interacts with SMAD4, a key mediator in TGF-β signaling pathways . This interaction may influence cellular differentiation and survival.

Applications in Research

The recombinant Xenopus laevis tcta protein serves as a tool for studying:

ApplicationDetails
Protein Interaction StudiesInvestigating homologous interactions (e.g., SMAD4) in non-mammalian systems.
Functional AssaysTesting osteoclastogenesis pathways in Xenopus models.
Antigen ProductionGenerating antibodies for immunological studies.

Related Products and Comparative Analysis

Recombinant TCTA proteins from other species are available for comparative studies:

SpeciesExpression SystemTagCatalog Number
Xenopus laevisE. coliHisRFL34327XF
Xenopus tropicalisE. coliHisRFL17996XF
HumanHuman cellsHis/DYKDDDDKEBE8414945
MouseMammalian cellsHis/Fc-AviTCTA-9093M

Key Research Findings

  1. Osteoclastogenesis Inhibition: Peptides targeting TCTA’s GQN motif inhibit human osteoclast formation, suggesting conserved functional domains across species .

  2. Evolutionary Conservation: TCTA homologs are present in Drosophila to humans, indicating ancient roles in cellular processes .

  3. Tumor Suppression: Reduced TCTA expression in SCLC cell lines hints at its potential role in oncogenesis .

Methodological Considerations

  • Storage: Lyophilized protein should be stored at -20°C/-80°C to avoid degradation. Reconstitution in sterile water with glycerol (5–50%) is recommended for long-term stability .

  • Functionality: The His tag may influence protein-protein interactions in assays; validation with tag-free variants is advised.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format requirement, kindly specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. For precise delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for a maximum of one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its implementation.
Synonyms
tcta; T-cell leukemia translocation-altered gene protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tcta
Target Protein Sequence
MAETWVSEIMTQALGCLQAFSSEFALEWESSDMKAAIFKLLLGWIVLSLTAILLAWKSYG PTVNSIYYRQGMGGQNGGTPEYPARFPVWESSSTESLKRHQE
Uniprot No.

Target Background

Database Links

KEGG: xla:734844

UniGene: Xl.50225

Protein Families
TCTA family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are effective for producing recombinant Xenopus laevis TCTA?

Several expression systems have proven effective for Xenopus proteins and would be applicable to TCTA:

Table 1: Expression Systems for Recombinant Xenopus Proteins

Expression SystemAdvantagesLimitationsApplication to TCTA
E. coliHigh yield, cost-effective, scalableLacks post-translational modifications, inclusion body formation commonSuitable for structural studies, requires optimization for folding
Baculovirus-infected insect cellsProper folding, post-translational modificationsMore expensive than bacterial systems, moderate yieldExcellent for functional studies requiring native-like protein
HEK293T mammalian cellsFull post-translational modifications, high-quality proteinLower yield, higher costIdeal for functional assays requiring mammalian modifications
Trichoplusia ni insect cellsGood yield, proper foldingModerate costEffective for purification with Ni-NTA affinity chromatography

When expressing Xenopus TCTA, consider that:

  • The inclusion of a proper signal sequence is critical for secreted protein production

  • For E. coli expression, refolding conditions may need optimization (typically including calcium for many Xenopus proteins)

  • Expression from Trichoplusia ni cells allows for easier scaling up compared to mammalian cells

How can I design primers for cloning Xenopus laevis TCTA?

For successful cloning of Xenopus laevis TCTA:

  • Begin with peptide sequences obtained from the target protein to clone the cDNA encoding this protein, as demonstrated with the accessory subunit of Xenopus laevis mitochondrial DNA polymerase gamma

  • Consider that Xenopus laevis has an allotetraploid genome, which may result in multiple gene copies or paralogs. This necessitates careful primer design to ensure specificity

  • For optimal amplification, design primers that:

    • Have 18-25 nucleotides in the gene-specific region

    • Maintain 40-60% GC content

    • Include appropriate restriction enzyme sites with 3-6 base overhangs

    • Have melting temperatures between 55-65°C

  • When designing a construct, consider including:

    • A 5' Kozak consensus sequence (GCCACC) before the start codon for efficient translation

    • A signal peptide sequence if the protein is to be secreted

    • Appropriate tags for purification (His-tag, for example)

    • TEV protease cleavage site for tag removal if necessary

What techniques are effective for analyzing TCTA protein function in Xenopus laevis?

Based on methodologies used for other Xenopus proteins, the following approaches are recommended for TCTA functional analysis:

  • Morpholino knockdown studies: Antisense morpholino oligonucleotides (MOs) can be used to study loss of gene function during development. These have been proven effective in both X. laevis and X. tropicalis .

  • Transgenic approaches: The CRISPR-Cas9-based "New and Easy Xenopus Transgenesis (NEXTrans)" method can be employed for targeted integration of transgenes. This allows for stable expression of TCTA variants or reporters .

  • Protein-protein interaction studies: Co-immunoprecipitation experiments can identify interaction partners. For TCTA, potential interaction candidates might include other membrane proteins or signaling pathway components .

  • Tissue-specific expression analysis: Whole-mount in situ hybridization protocols developed for X. laevis can be applied without alteration to examine the spatial expression pattern of TCTA during development .

  • Functional rescue experiments: Following knockdown, wild-type or mutant forms of TCTA can be introduced to assess functional rescue, helping to identify critical domains and residues .

How can I determine the biochemical properties and ligand binding characteristics of TCTA?

Based on protocols used for other Xenopus proteins like XCGL-1, a systematic approach would include:

  • Oligomeric state analysis:

    • Use non-reducing vs. reducing SDS-PAGE to detect disulfide-linked oligomers

    • Apply analytical ultracentrifugation or size exclusion chromatography for native state determination

    • Electron microscopy can reveal structural organization

  • Ligand binding studies:

    • Bio-layer interferometry (BLI) for kinetic binding parameters (ka, kd, KD)

    • Competitive binding assays with potential ligands

    • Isothermal titration calorimetry for thermodynamic parameters

  • Structural analysis:

    • Circular dichroism spectroscopy for secondary structure content

    • Limited proteolysis to identify domain boundaries

    • Molecular modeling based on homologous proteins

Table 2: Example Binding Kinetics Protocol (based on methods for other Xenopus proteins)

StepProcedureParametersNotes
1Protein preparation50-100 μg/mL in binding bufferUse freshly purified protein
2Biosensor preparationImmobilize biotinylated ligand on streptavidin sensorAim for 1-2 nm shift after loading
3AssociationDip sensor in protein solutionTest multiple concentrations (10-500 nM)
4DissociationTransfer to buffer onlyMonitor for at least 3× association time
5AnalysisFit to 1:1 binding modelCalculate ka, kd, and KD values

How can contradictions in TCTA functional data be analyzed and resolved?

When faced with contradictory findings in TCTA research, a structured approach to contradiction analysis can be valuable:

  • Systematic classification of contradictions:

    • Use the (α, β, θ) notation system where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimal number of Boolean rules required

    • Apply this framework to organize contradictory results about TCTA function

  • Topological data analysis approach:

    • Topological features can reflect essential characteristics of data and reduce the impact of noise

    • This approach has been shown useful for detecting more latent and complex contradictions

    • Apply TDA to enhance deep learning models for analyzing contradictory results in TCTA research

  • Contradiction classification framework:

    • Categorize contradictions into types (e.g., Negation, Antonym, Replacement, Switch, Scope, and Latent)

    • Different contradiction types may require different resolution approaches

  • Experimental validation:

    • Design experiments that directly test contradictory hypotheses

    • Use multiple complementary methodologies to verify results

    • Ensure consistent experimental conditions across studies

How can CRISPR-Cas9 technology be utilized for TCTA studies in Xenopus laevis?

CRISPR-Cas9 technology offers powerful approaches for TCTA research in Xenopus:

  • Targeted transgenesis with NEXTrans:

    • The NEXTrans protocol enables CRISPR-Cas9-mediated targeted integration of transgenes at a safe harbor site

    • For TCTA studies, this can be used to integrate reporter constructs driven by the TCTA promoter to monitor expression patterns

  • Protocol for TCTA locus targeting:

    • Design sgRNA targeting TCTA locus (e.g., 5′-TAATACGACTCACTATAGGNNNNNNNNNNNNNNNNNNGTTTTAGAGCTAGAAATAGCAAG-3′)

    • Co-inject sgRNA, Cas9 protein, and donor DNA into fertilized Xenopus eggs

    • Validate integration by genomic PCR

  • Generation of TCTA knockout lines:

    • Design sgRNAs targeting early exons of TCTA

    • Use T7 promoter-based transcription for sgRNA synthesis

    • Validate knockout by sequencing and protein expression analysis

  • Conditional expression systems:

    • Develop tissue-specific or inducible TCTA expression systems using CRISPR-based approaches

    • This allows for temporal and spatial control of TCTA expression

What is known about the evolutionary relationship of TCTA across species?

The evolutionary relationships of TCTA can provide important context for functional studies:

  • Homology analysis:

    • TCTA in Xenopus laevis shows significant homology to its human, mouse, and Drosophila counterparts

    • Interestingly, TCTA also exhibits significant homology to glycyl-tRNA synthetases from prokaryotic organisms, revealing a likely evolutionary relationship

  • Evolutionary conservation:

    • The high degree of conservation suggests important functional roles

    • Comparative analysis between X. laevis (allotetraploid) and X. tropicalis (diploid) can provide insights into gene duplication and subfunctionalization

  • Structural evolution:

    • Molecular modeling approaches can predict structural similarities and differences between TCTA proteins across species

    • These analyses can identify conserved functional domains and species-specific adaptations

  • Functional conservation testing:

    • Cross-species rescue experiments can test functional conservation

    • For example, testing if human TCTA can rescue phenotypes in Xenopus TCTA knockdown models

How can micro-CT imaging contribute to understanding TCTA expression and function in Xenopus development?

Micro-CT imaging provides powerful approaches to analyze protein expression patterns in three dimensions:

  • Developmental expression mapping:

    • Micro-CT allows examination of developmental and morphological changes at micrometer scale

    • For TCTA studies, this can be combined with reporter constructs to visualize expression patterns across developmental stages

  • Integration with transgenic approaches:

    • Combine TCTA reporter transgenics with micro-CT to create high-resolution 3D models of expression patterns

    • This can reveal detailed spatial relationships between TCTA expression and developing structures

  • Temporal analysis across metamorphosis:

    • Track TCTA expression from premetamorphosis through climax metamorphosis to adult stages

    • This is particularly valuable as Xenopus undergoes significant tissue remodeling during metamorphosis

Table 3: Developmental Stages for TCTA Expression Analysis Using Micro-CT

Developmental PhaseNieuwkoop-Faber StagesKey FeaturesRelevance to TCTA
Premetamorphosis44-45, 52, 53Initial stages of developmentEstablish baseline expression
Prometamorphosis54, 57Significant changes in head, limb buds, tailMonitor changes during tissue remodeling
Climax Metamorphosis58-65Major transformation from tadpole to frogletAssess expression during cellular differentiation
FrogletPost-stage 66Recently metamorphosedExamine expression in mature tissues
AdultFully matureComplete developmentEstablish adult expression pattern

What are the key differences between using X. laevis versus X. tropicalis for TCTA studies?

When choosing between Xenopus species for TCTA research, consider these important differences:

Table 4: Comparison of X. laevis and X. tropicalis for TCTA Research

FeatureX. laevisX. tropicalisImplications for TCTA Research
GenomeAllotetraploidDiploidX. tropicalis offers simpler genetic analysis
Generation time1-2 years4 monthsX. tropicalis enables faster genetic studies
Embryo sizeLarger (1-1.4 mm)SmallerX. laevis provides more material for biochemical studies
Temperature range14-23°CNarrowerX. laevis offers more flexibility in experimental conditions
Resource availabilityExtensive protocolsGrowing resourcesBoth have valuable tools, but X. laevis has more established protocols
Genetic toolsWell-establishedExpanding rapidlyX. tropicalis facilitates genetic approaches including forward genetics

Key considerations:

  • X. laevis has an allotetraploid genome which may complicate genetic analyses but might offer redundancy benefits

  • X. tropicalis has a shorter generation time (4 months vs. 1-2 years), making it more suitable for multi-generational studies

  • Many analytical reagents (antibodies, protocols) developed for X. laevis can be effectively transferred to X. tropicalis

  • The developmental staging system of Nieuwkoop and Faber can be applied to both species

What controls should be included when performing functional analysis of TCTA in Xenopus?

Proper controls are essential for robust TCTA functional studies:

  • For transgenic experiments:

    • Include both positive controls (known functional constructs) and negative controls (empty vectors)

    • Use different promoters to control for position effects versus promoter-specific effects

    • Include reporter-only controls to distinguish promoter activity from endogenous expression

  • For morpholino knockdown studies:

    • Include standard control morpholinos

    • Perform rescue experiments with morpholino-resistant mRNA constructs

    • Use multiple morpholinos targeting different regions of the transcript

    • Include dose-response studies to establish specificity

  • For CRISPR-Cas9 experiments:

    • Include non-targeting sgRNA controls

    • Validate edits by sequencing

    • Perform off-target analysis

    • Include rescue experiments with wild-type TCTA

  • For protein interaction studies:

    • Include IgG controls for immunoprecipitation

    • Use irrelevant proteins as negative controls

    • Perform reciprocal co-IPs when possible

    • Include domain deletion controls to map interaction sites

How can contradictory findings in TCTA research be resolved through improved experimental design?

To resolve contradictions in TCTA research:

  • Standardize experimental conditions:

    • Use consistent developmental stages (based on Nieuwkoop and Faber staging)

    • Standardize temperature conditions (X. laevis embryos develop between 14-23°C, with developmental rate varying predictably with temperature)

    • Maintain consistent husbandry conditions to minimize environmental variables

  • Employ multiple complementary techniques:

    • Combine in situ hybridization, immunohistochemistry, and reporter assays for expression studies

    • Integrate loss-of-function (morpholinos, CRISPR) with gain-of-function (overexpression) approaches

    • Use both in vivo and in vitro approaches to validate findings

  • Increase biological replication:

    • Use sufficient biological replicates (minimum n=3 independent experiments)

    • Consider natural variation between egg batches

    • Apply appropriate statistical analyses to determine significance

  • Cross-validate between species:

    • Confirm key findings in both X. laevis and X. tropicalis

    • Extend to mammalian systems when possible to establish evolutionary conservation

How can studies of TCTA in Xenopus inform understanding of human disease pathways?

Xenopus TCTA studies can provide valuable insights into human disease mechanisms:

  • Cancer biology connections:

    • Human TCTA was originally identified in association with T-cell leukemia

    • Studying TCTA function in Xenopus can reveal conserved mechanisms relevant to human leukemia

    • Xenopus provides a versatile platform for cancer biology and immunotherapy research

  • Developmental disorder insights:

    • TCTA's developmental role in Xenopus may inform understanding of congenital disorders

    • The transparent nature of Xenopus tadpoles allows for intravital studies of developmental processes

  • Immunological applications:

    • Xenopus represents a powerful model for comparative immunology

    • TCTA studies in Xenopus can provide evolutionary perspective on immune system functions

    • The amphibian immune system shows remarkable similarity to mammals despite evolutionary distance

  • Therapeutic target validation:

    • Functional studies in Xenopus can validate potential therapeutic targets

    • The accessibility of early developmental stages allows for rapid screening of pathway interventions

What approaches enable effective translation between Xenopus and human TCTA studies?

To maximize translational value from Xenopus TCTA research:

  • Domain-focused functional analysis:

    • Identify conserved functional domains between Xenopus and human TCTA

    • Focus mechanistic studies on these conserved regions

    • Use domain swapping experiments to test functional conservation

  • Humanized Xenopus models:

    • Create transgenic Xenopus expressing human TCTA variants

    • Test human disease-associated variants in Xenopus systems

    • Develop high-throughput screening approaches using Xenopus embryos

  • Parallel pathway analysis:

    • Map signaling pathways involving TCTA in both systems

    • Identify conserved and divergent interaction partners

    • Use this information to build more accurate models of human TCTA function

  • Complementary model systems:

    • Validate key findings across multiple model systems (Xenopus, zebrafish, mammalian cells)

    • Leverage the unique advantages of each system

    • Build an integrated understanding of TCTA function across evolutionary distance

What are the most promising future directions for TCTA research in Xenopus?

Based on current knowledge and methodological capabilities, the following represent key opportunities for advancing TCTA research:

  • Comprehensive expression mapping:

    • Generate detailed spatiotemporal maps of TCTA expression throughout development

    • Apply single-cell transcriptomic approaches to identify cell-specific expression patterns

    • Develop reporter lines for live imaging of TCTA expression dynamics

  • Functional genomics approaches:

    • Apply CRISPR-Cas9 genome editing for targeted knockouts and knock-ins

    • Identify genetic modifiers of TCTA function through forward genetic screens

    • Map the TCTA interactome through proteomics approaches

  • Evolutionary analysis:

    • Compare TCTA function across amphibian species

    • Investigate the evolutionary relationship with prokaryotic glycyl-tRNA synthetases

    • Reconstruct the evolutionary history of TCTA regulatory networks

  • Disease modeling:

    • Develop Xenopus models of human diseases involving TCTA dysregulation

    • Test potential therapeutic approaches in these models

    • Use insights from comparative studies to identify novel intervention points

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.