Recombinant Xenopus laevis Tetraspanin-31-A (tspan31-a)

What is Xenopus laevis Tetraspanin-31-A and how does it differ from Tetraspanin-31-B?

Xenopus laevis Tetraspanin-31-A (tspan31-a) is a member of the tetraspanin family of integral membrane proteins found in the African clawed frog. It is also known as sas-a (Sarcoma-amplified sequence homolog A) and is encoded by the tspan31-a gene . The full-length protein consists of 212 amino acids and functions as a membrane-spanning protein with characteristic tetraspanin structure .

Tetraspanin-31-A differs from Tetraspanin-31-B primarily in their genomic origins and sequence variations. While tspan31-a is associated with the S homeolog chromosome, tspan31-b corresponds to the L homeolog chromosome in the pseudotetraploid X. laevis genome . This distinction is important when designing experiments, as primers and antibodies may exhibit different specificities for each variant. Both forms share the fundamental tetraspanin family characteristics but may have diverged in certain functional aspects following genome duplication in X. laevis.

What is the amino acid sequence and structural characteristics of recombinant tspan31-a?

The full amino acid sequence of Xenopus laevis Tetraspanin-31-A consists of 212 amino acids as follows:

MVCGGFTCSKNALCALNVVYMLVGLLLIGVAAWGKGFGIVSSIHIIGGVIAIGVFLLLIA IIGLIGAVSHHQVMLFIYMVVLILVFIFQFIVSCSCLAMNRSQQEYFLNTTWRRMSNETR LNLEETLECCGFLNTTEARELFNKDVALCSHVCPDPHKCLSCGDKMLNHADEALKILGGV GLFFSFTEILGVWLAFRFRNQKDPRANPSAFL

Structurally, as a tetraspanin family member, tspan31-a contains four transmembrane domains with characteristic intracellular N and C termini, a small extracellular loop (EC1), and a larger extracellular loop (EC2) containing conserved cysteine residues that form disulfide bonds. The protein's hydrophobic regions facilitate its integration into cell membranes, while the extracellular domains mediate interactions with other membrane proteins and extracellular matrix components .

What expression systems are available for producing recombinant tspan31-a?

Multiple expression systems are available for producing recombinant Xenopus laevis tspan31-a, each with distinct advantages depending on research requirements:

The choice of expression system should be based on experimental requirements. E. coli-produced protein is suitable for applications where glycosylation is not critical, while mammalian or baculovirus systems are preferred when post-translational modifications are essential for functional studies .

How should recombinant tspan31-a be stored and handled to maintain structural integrity?

Proper storage and handling of recombinant tspan31-a is critical for maintaining its biological activity and structural integrity. Based on established protocols, the following guidelines are recommended:

Long-term storage: Recombinant tspan31-a should be stored at -20°C to -80°C, with the latter preferred for extended storage periods. The lyophilized form offers greater stability than solutions . For proteins in solution, storage in small aliquots is essential to avoid repeated freeze-thaw cycles that can lead to protein degradation and aggregation .

Buffer composition: Tris/PBS-based buffers with 6% trehalose at pH 8.0 provide optimal stability. For long-term storage in solution, addition of 5-50% glycerol (typically 50%) helps prevent freeze damage and maintains protein conformation .

Reconstitution procedure: Prior to reconstitution, the vial should be briefly centrifuged to collect all material at the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . After reconstitution, working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be strictly avoided .

These storage conditions minimize conformational changes and preserve the functional characteristics of the recombinant protein for experimental applications.

What purification methods yield the highest purity for recombinant tspan31-a?

Achieving high-purity recombinant tspan31-a requires strategic purification approaches tailored to the expression system and experimental needs:

For His-tagged recombinant tspan31-a expressed in E. coli, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides the initial purification step, typically achieving 70-80% purity. This is commonly followed by size-exclusion chromatography to remove aggregates and further increase purity to ≥90% as determined by SDS-PAGE .

For antibody purification against tspan31, immunogen affinity chromatography has proven effective, yielding highly specific antibodies suitable for Western blot applications . This technique can be particularly valuable when studying both tspan31-a and tspan31-b variants to ensure specificity.

Quality control methods should include SDS-PAGE analysis under both reducing and non-reducing conditions to verify purity and assess disulfide bond formation in the extracellular domains. For membrane proteins like tspan31-a, addition of mild detergents during purification helps maintain solubility while preserving native conformation .

What validation methods confirm the identity and functionality of purified recombinant tspan31-a?

Validating recombinant tspan31-a requires multiple complementary approaches to confirm both identity and biological functionality:

Identity Confirmation:

• Mass spectrometry analysis to verify the exact molecular weight and sequence coverage

• Western blot using specific anti-tspan31 antibodies to confirm immunoreactivity

• N-terminal sequencing to verify correct processing of the initial amino acids

Functionality Assessment:

• Circular dichroism spectroscopy to evaluate secondary structure integrity, particularly important for transmembrane proteins

• Membrane integration assays using artificial liposomes to confirm proper folding and insertion capability

• Protein-protein interaction studies to verify the ability to engage with known binding partners

For recombinant tspan31-a intended for interaction studies, surface plasmon resonance (SPR) can be employed to measure binding kinetics with potential partner proteins. Additionally, when studying potential cancer-related mechanisms, validating the ability of the protein to activate relevant signaling pathways (such as PI3K-Akt, based on human TSPAN31 studies) provides functional confirmation .

How can recombinant tspan31-a be used to study membrane protein interactions in amphibian systems?

Recombinant tspan31-a serves as a valuable tool for investigating membrane protein interactions in amphibian systems through several methodological approaches:

Co-immunoprecipitation Studies: Recombinant tspan31-a with affinity tags can be used to pull down interacting proteins from Xenopus cell or tissue lysates. This approach helps identify novel binding partners and elucidate the composition of tetraspanin-enriched microdomains (TEMs) in amphibian membranes. The high purity (≥90% for E. coli-expressed protein) ensures specific interactions are captured .

Reconstitution in Artificial Membranes: Purified recombinant tspan31-a can be incorporated into liposomes or nanodiscs to study its membrane organization and interaction with other membrane components in a controlled environment. This system allows precise manipulation of lipid composition to determine how membrane environment influences tetraspanin function.

Proximity Labeling in Live Cells: Tagged recombinant tspan31-a can be introduced into Xenopus cells for proximity labeling experiments (BioID or APEX2) to identify proteins in the immediate vicinity of tspan31-a in their native cellular context.

What is the significance of studying tspan31-a in developmental biology and comparative research?

Studying tspan31-a in developmental biology and comparative research provides valuable insights into several key biological processes:

Evolutionary Conservation: Analysis of tspan31-a in Xenopus laevis allows researchers to trace the evolutionary trajectory of tetraspanin proteins across vertebrate lineages. The presence of both tspan31-a and tspan31-b paralogs in X. laevis due to its pseudotetraploid genome makes it an excellent model for studying gene duplication and subfunctionalization events .

Developmental Regulation: Examination of tspan31-a expression patterns throughout embryonic development can reveal stage-specific and tissue-specific functions. The Xenopus model system is particularly advantageous for these studies due to its external development and established fate maps.

Comparative Oncology: Given that human TSPAN31 plays a crucial role in cancer progression, as evidenced by its involvement in gastric cancer through the PI3K-Akt pathway and influence on epithelial-mesenchymal transition , studying the amphibian homologs provides an evolutionary perspective on how these oncogenic functions emerged and diversified across vertebrate species.

When designing comparative studies, researchers should account for the genomic complexity of X. laevis with its distinct S and L homeologs (tspan31.S and tspan31.L) to ensure accurate interpretation of results .

How does tspan31-a research inform our understanding of cancer biology?

Research on tspan31-a can contribute significantly to cancer biology understanding through comparative analysis with human TSPAN31, which has established oncogenic properties:

Human TSPAN31 overexpression is associated with malignant potential in gastric cancer, correlating with lymphatic invasion, venous invasion, advanced tumor stages, and higher recurrence rates . Analysis of the conserved domains and signaling mechanisms between Xenopus tspan31-a and human TSPAN31 can identify evolutionarily preserved oncogenic pathways.

In human gastric cancer, TSPAN31 influences several cancer-related processes:

• Cell proliferation and apoptosis regulation

• Migration and invasion capacity

• Epithelial-mesenchymal transition (EMT)

• Chemosensitivity modulation through ABCC2

• Signaling through the PI3K-Akt pathway

Investigating whether Xenopus tspan31-a can interact with similar signaling components provides evolutionary context for these oncogenic mechanisms. Furthermore, using recombinant tspan31-a protein in structure-function studies can help identify critical domains responsible for these interactions, potentially leading to the development of targeted therapeutic approaches for TSPAN31-overexpressing human cancers .

How do tspan31-a and tspan31-b paralogs differ functionally, and what experimental approaches can distinguish them?

The tspan31-a and tspan31-b paralogs in Xenopus laevis represent an intriguing case of gene duplication resulting from the pseudotetraploid nature of this species. Distinguishing between these paralogs requires sophisticated experimental approaches:

Sequence-Based Differentiation:
The paralogs can be distinguished at the nucleotide level using paralog-specific PCR primers targeting divergent regions. For protein-level differentiation, mass spectrometry can identify unique peptides specific to each paralog .

Expression Pattern Analysis:
RNA in situ hybridization with paralog-specific probes can reveal differences in temporal and spatial expression patterns during development. Complementing this with immunohistochemistry using antibodies that can discriminate between the variants provides protein-level localization data .

Functional Characterization:
CRISPR/Cas9-mediated paralog-specific knockout in Xenopus can reveal distinct phenotypes and downstream effects on signaling pathways. Additionally, rescue experiments using recombinant proteins can confirm paralog-specific functions. When performing these studies, it's essential to verify the specificity of targeting to avoid cross-reactivity between the highly similar paralogs .

The evolutionary divergence between these paralogs may provide insights into subfunctionalization or neofunctionalization processes following gene duplication events, making them valuable models for studying protein evolution.

What techniques are most effective for studying tspan31-a interactions within tetraspanin-enriched microdomains (TEMs)?

Investigating tspan31-a within tetraspanin-enriched microdomains (TEMs) requires specialized techniques that preserve membrane integrity and capture dynamic protein interactions:

Detergent Resistance Analysis:
TEMs can be isolated based on their resistance to certain detergents. Using a gradient of detergents with different stringencies can help define the stability of tspan31-a associations within these microdomains. Mild detergents like CHAPS preserve tetraspanin interactions better than stronger detergents like Triton X-100.

Super-Resolution Microscopy:
Techniques such as STORM, PALM, or STED microscopy allow visualization of tspan31-a organization within membrane domains at nanometer resolution. These approaches can reveal clustering patterns and co-localization with other membrane proteins that conventional microscopy cannot resolve.

Chemical Crosslinking coupled with Mass Spectrometry (XL-MS):
This approach captures transient protein interactions by covalently linking proteins in close proximity before analysis. For membrane proteins like tspan31-a, membrane-permeable crosslinkers with varying arm lengths can help map the spatial organization of interaction networks.

Quantitative Proteomics of Isolated TEMs:
Stable isotope labeling combined with immunoprecipitation of tspan31-a can identify and quantify changes in TEM composition under different physiological conditions. This approach has revealed that tetraspanins often function as molecular organizers of membrane microdomains, influencing the localization and function of associated proteins .

What are the challenges in comparing amphibian tspan31-a function with human TSPAN31, and how can they be addressed?

Comparative analysis between amphibian tspan31-a and human TSPAN31 presents several methodological challenges that require careful experimental design:

Evolutionary Distance and Sequence Divergence:
Despite functional conservation, sequence differences between amphibian and human tetraspanins can affect protein-protein interactions. Chimeric proteins containing domains from both species can help identify functionally conserved regions. Sequence alignment and homology modeling should precede functional studies to identify conserved motifs that might mediate similar interactions .

Cellular Context Differences:
The membrane composition and cellular machinery differ between amphibian and mammalian cells, potentially affecting tetraspanin function. To address this, heterologous expression studies can be conducted where both proteins are expressed in the same cellular background to directly compare their functions. Additionally, replacing endogenous human TSPAN31 with Xenopus tspan31-a in human cell lines can reveal the degree of functional conservation .

Signaling Pathway Conservation:
Human TSPAN31 influences cancer progression through the PI3K-Akt pathway . When investigating whether tspan31-a activates similar pathways in amphibian cells, researchers should first confirm the presence and conservation of pathway components using comparative genomics and biochemical validation. Phospho-specific antibodies against conserved epitopes can help track signaling events across species .

This comparative approach has significant implications for using Xenopus as a model system for human diseases associated with TSPAN31 dysregulation, particularly in cancer research contexts.

What are common challenges in expressing recombinant tspan31-a and strategies to overcome them?

Recombinant expression of membrane proteins like tspan31-a presents several challenges that require specific optimization strategies:

Protein Aggregation and Inclusion Body Formation:
When expressed in E. coli, transmembrane proteins often form inclusion bodies. This can be mitigated by:

• Reducing expression temperature (16-20°C)

• Using specialized E. coli strains (C41/C43 or Rosetta)

• Adding mild detergents or lipids to the culture medium

• Employing fusion partners like MBP or SUMO that enhance solubility

Low Yield in Mammalian/Insect Systems:
Expression in more complex systems may result in lower yields but better folding. Optimization approaches include:

• Codon optimization for the expression host

• Inducible expression systems to minimize toxicity

• Testing different signal sequences for improved membrane targeting

• Co-expression with chaperones specific to membrane proteins

Purification Challenges:
Membrane proteins require detergents during purification, which can affect structure and function:

• Screen multiple detergents (DDM, LMNG, CHAPS) for optimal extraction

• Use lipid nanodiscs or amphipols for detergent-free final preparations

• Implement two-step purification (affinity chromatography followed by size exclusion) to separate aggregates from properly folded protein

The choice between partial length (suitable for soluble domains) and full-length constructs depends on the research question, with both options available for tspan31-a .

How can researchers address issues with antibody cross-reactivity between tspan31-a and other tetraspanin family members?

Antibody cross-reactivity is a significant challenge when studying tetraspanin family members due to their structural similarities. Researchers can implement several strategies to ensure specificity:

Epitope Selection:

• Target the most divergent regions, typically within the variable regions of the large extracellular loop (EC2)

• Avoid the highly conserved transmembrane domains or cytoplasmic regions

• Consider using peptide antigens from unique regions rather than whole protein immunization

Validation Approaches:

• Test antibody specificity against recombinant tspan31-a and tspan31-b separately

• Include knockout/knockdown controls to confirm signal specificity

• Perform pre-absorption tests with the immunizing peptide to verify that it blocks detection

• Use multiple antibodies targeting different epitopes to confirm results

Technical Optimizations:

• Increase stringency in immunoblotting by adjusting salt concentration and detergent levels

• Implement more specific detection methods like proximity ligation assays

• Consider using alternative approaches like RNA-based detection (RNAscope) for paralogs with high protein similarity but distinct nucleotide sequences

Commercially available anti-TSPAN31 antibodies, like those mentioned in the search results, have been purified by immunogen affinity chromatography to enhance specificity, making them suitable for Western blot applications .

What are the best practices for experimental design when comparing tspan31-a with human TSPAN31 in functional studies?

When designing comparative functional studies between Xenopus tspan31-a and human TSPAN31, several methodological considerations ensure meaningful results:

Expression Level Normalization:
Differences in expression levels can confound functional comparisons. Researchers should:

• Use inducible expression systems with titratable promoters

• Verify protein expression by Western blot before functional assays

• Normalize functional data to protein expression levels

• Consider stable cell lines with comparable expression levels

Cellular Context Selection:
The choice of cellular background significantly impacts results:

• Use cells lacking endogenous expression of either protein

• Consider both amphibian and mammalian cellular backgrounds

• For cancer-related studies, select cell lines relevant to known TSPAN31 functions (e.g., gastric cancer cell lines)

Functional Endpoint Selection:
Based on human TSPAN31 studies in gastric cancer, key functional endpoints should include:

• Cell proliferation (measured by MTT/BrdU incorporation)

• Apoptosis resistance (Annexin V/PI staining, caspase activity)

• Migration and invasion capacity (Transwell assays)

• EMT marker expression (E-cadherin, vimentin, etc.)

• PI3K-Akt pathway activation (phospho-specific Western blots)

Controls and Validation:

• Include domain swapping experiments to identify regions responsible for different functions

• Use siRNA/CRISPR to knock down endogenous proteins and verify specificity of effects

• Perform rescue experiments with the orthologous protein to confirm functional conservation

These methodological approaches help establish whether the oncogenic properties of human TSPAN31 are evolutionarily conserved in Xenopus tspan31-a, providing insights into fundamental mechanisms of tetraspanin function in cancer biology.