Recombinant Xenopus laevis Tetraspanin-31-B (tspan31-b)

What is the molecular structure of Xenopus laevis Tetraspanin-31-B?

Xenopus laevis Tetraspanin-31-B (tspan31-b) is a member of the tetraspanin family of scaffold proteins characterized by four transmembrane domains, two extracellular loops, and intracellular N- and C-termini. The full-length protein consists of 212 amino acids with the sequence: MVCGGFTCSKNALCALNVVYMLVGLLLIGVAAWGKGFGIVSSIHIIGGVIAIGVFLLLIAIIGL IGAVSHHQVMLFIYMVVLILVFIFQFIVSCSCLAMNRSQQEYFLNTTWRRMSNNETRLNLEETLECCGF LNTTEARELFNKDVALCSHVCPDPHKCLSCGDKMLNHADEALKILGGVGLFFSFTEILGVWLAFRFRNQ KDPRANPSAFL . Like other tetraspanins, it likely organizes membrane microdomains that serve as multipurpose adapters in cellular signaling and membrane organization .

What are the known synonyms and gene designations for tspan31-b?

Tetraspanin-31-B has several synonyms and gene designations in the scientific literature. These include tspan31-b, sas-b, sas, tspan31, tetraspanin 31, and tetraspanin 31 L homeolog . Understanding these alternative nomenclatures is essential when conducting literature searches or database queries to ensure comprehensive data collection for research involving this protein.

What are the expression patterns of tspan31-b during Xenopus development?

Based on studies of tetraspanin family members in Xenopus, tspan31-b likely shows tissue-specific expression during development. While the exact expression pattern of tspan31-b has not been specifically detailed in the provided literature, tetraspanins in general show prominent expression in specific organs during Xenopus development, including the notochord, eye, cranial neural crest cells (CNCs), trunk neural crest cells, placodes, and somites . Expression analysis using in situ hybridization with tspan31-b-specific probes would be necessary to determine its precise spatiotemporal expression pattern during development.

What methodologies are recommended for studying tspan31-b expression in Xenopus embryos?

For studying tspan31-b expression patterns in Xenopus embryos, the following methods are recommended:

• In situ hybridization (ISH): Using tspan31-b-specific probes to detect mRNA localization in different tissues at various developmental stages. This approach has successfully revealed expression patterns of related tetraspanins such as cd63 in Xenopus .

• RT-PCR and qPCR: For quantitative assessment of tspan31-b expression levels across developmental stages and tissues.

• Immunohistochemistry: Using specific antibodies against tspan31-b, though this requires validation of antibody specificity.

• Reporter gene constructs: Creating fusion constructs of the tspan31-b promoter region with reporter genes like GFP to visualize expression dynamics in live embryos.

Each of these approaches provides complementary information about the spatiotemporal expression pattern of tspan31-b during Xenopus development.

What are the optimal conditions for expression and purification of recombinant tspan31-b protein?

Recombinant Xenopus laevis tspan31-b protein can be expressed in several expression systems with the following optimal conditions:

For optimal results, purified protein should be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and aliquoted with 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles .

What functional assays can be used to study tspan31-b in Xenopus development?

Several functional assays can be employed to study the role of tspan31-b in Xenopus development:

• Morpholino-mediated knockdown: Design of translation-blocking morpholino oligomers targeting the 5'UTR of tspan31-b mRNA to block protein synthesis, similar to approaches used for cd63 .

• CRISPR/Cas9 genome editing: Generation of targeted mutations in the tspan31-b gene to create loss-of-function models.

• Overexpression studies: Microinjection of synthetic tspan31-b mRNA to assess gain-of-function effects.

• Rescue experiments: Co-injection of wild-type tspan31-b mRNA with morpholinos to validate specificity of knockdown phenotypes.

• Protein localization studies: Expression of fluorescently tagged tspan31-b to track its subcellular distribution and potential association with specific organelles or membrane domains.

These approaches can reveal the functional requirements of tspan31-b during development and its potential roles in specific developmental processes.

How should researchers design experiments to investigate tspan31-b and tspan31-a redundancy or distinct functions?

To investigate potential redundancy or distinct functions between tspan31-b and tspan31-a, researchers should consider the following experimental design strategies:

• Comparative expression analysis: Perform side-by-side in situ hybridization with specific probes for each homeolog to identify overlapping or distinct expression domains.

• Individual knockdown experiments: Design specific morpholinos or CRISPR guides targeting each homeolog separately to assess unique phenotypes.

• Double knockdown experiments: Simultaneously target both homeologs to uncover potentially redundant functions.

• Cross-rescue experiments: Test whether overexpression of one homeolog can rescue defects caused by knockdown of the other.

• Domain-swapping experiments: Create chimeric constructs exchanging domains between tspan31-a and tspan31-b to identify functional domains responsible for specific activities.

• Co-immunoprecipitation and protein interaction studies: Compare the interactome of each homeolog to identify common and distinct binding partners.

This multi-faceted approach would provide comprehensive insights into the relationship between these two homeologs and their potentially specialized functions during Xenopus development.

How might tspan31-b contribute to tetraspanin-enriched microdomains in Xenopus cell membranes?

Tetraspanins, including tspan31-b, likely form specialized membrane microdomains known as "tetraspanin-enriched microdomains" (TEMs) that organize the plasma membrane and serve as multipurpose adapters . Based on studies of tetraspanin biology, tspan31-b may:

• Interact with specific membrane and cytosolic proteins to form molecular complexes that regulate signal transduction pathways.

• Contribute to the organization of membrane heterogeneity, potentially influencing intercellular communication as suggested for other tetraspanins in Xenopus .

• Associate with specific lipid species to create specialized membrane environments that facilitate protein-protein interactions.

• Participate in the formation or composition of extracellular vesicles, as many tetraspanins are enriched in exosomes and other EVs .

Advanced imaging techniques such as super-resolution microscopy combined with proximity labeling approaches would be valuable for investigating the specific composition and dynamics of tspan31-b-containing TEMs in Xenopus cells.

What are the challenges in studying tspan31-b interactions with other membrane proteins?

Studying tspan31-b interactions with other membrane proteins presents several technical challenges:

• Preserving native membrane environments: Conventional protein interaction studies often disrupt membrane integrity, potentially disrupting authentic interactions. Mild detergents or membrane-preserving crosslinking approaches are necessary.

• Dynamic and potentially weak interactions: Tetraspanin interactions may be transient or context-dependent, requiring specialized techniques like FRET (Fluorescence Resonance Energy Transfer) or BiFC (Bimolecular Fluorescence Complementation) to capture.

• Distinguishing direct from indirect interactions: Tetraspanins often form complex interaction networks, making it difficult to distinguish direct binding partners from proteins that are part of larger complexes.

• Potential redundancy with other tetraspanins: Functional compensation by other tetraspanins may mask phenotypes in loss-of-function studies.

• Tissue-specific interaction profiles: Tspan31-b may interact with different partners depending on cell type and developmental context, requiring tissue-specific analysis approaches.

Recent advances in proximity labeling techniques (BioID, APEX) coupled with mass spectrometry offer promising approaches to overcome these challenges and map the tspan31-b interactome in specific cellular contexts.

What is the potential role of tspan31-b in exosome biology during Xenopus development?

Tetraspanins are known to be enriched in exosomes and other extracellular vesicles (EVs), suggesting tspan31-b may play a role in EV biology during Xenopus development. Research on other tetraspanins indicates potential functions in:

• Exosome biogenesis: Tetraspanins may participate in the sorting of cargo into intraluminal vesicles of multivesicular bodies (MVBs) that later become exosomes.

• Exosome targeting: Surface tetraspanins may influence the targeting of exosomes to specific recipient cells during development.

• Intercellular communication: As noted in the literature, "expression of multiple Tspans in a particular tissue might produce heterogeneity of intercellular communication" , potentially through exosome-mediated signaling.

• Developmental signaling: EVs may transport morphogens, signaling molecules, or regulatory RNAs between cells during development, with tetraspanins potentially influencing the specificity of these transfers.

How conserved is tspan31-b across vertebrate species and what does this suggest about its function?

Evolutionary conservation analysis of tspan31-b would provide insights into its functional importance. While specific conservation data for tspan31-b is not provided in the search results, the following approaches would be valuable for assessing its evolutionary significance:

• Sequence alignment analysis: Comparing tspan31 sequences across vertebrate species to identify conserved domains and residues that might be functionally critical.

• Synteny analysis: Examining the genomic context of tspan31 genes across species to understand evolutionary relationships.

• Phylogenetic analysis: Constructing phylogenetic trees to determine the evolutionary history of tspan31 genes and their relationship to other tetraspanin family members.

• Expression pattern comparison: Analyzing whether expression domains are conserved across species, which would suggest conserved developmental functions.

Highly conserved regions would likely represent functionally important domains, while species-specific variations might indicate adaptations to specific developmental or physiological requirements.

What insights can be gained from comparing tspan31-b function to other tetraspanins in Xenopus?

Comparing tspan31-b to other tetraspanins in Xenopus, particularly those with known functions like cd63, can provide valuable insights:

• Functional specialization: Other tetraspanins such as cd63 have been shown to have specific developmental roles, such as in eye morphogenesis in Xenopus . Comparing phenotypes from loss-of-function studies could reveal whether tspan31-b has similar tissue-specific requirements.

• Expression pattern comparison: Tetraspanins show "prominent expression in specific organs such as the notochord, eye, cranial neural crest cells (CNCs), trunk neural crest cells, placodes, and somites" . Determining whether tspan31-b shares expression domains with other tetraspanins could suggest functional relationships.

• Interaction partner overlap: Identifying whether tspan31-b shares interaction partners with other tetraspanins would illuminate potential functional redundancy or specialization.

• Subcellular localization patterns: Comparing the subcellular distribution of tspan31-b with other tetraspanins might reveal specialized roles in particular cellular compartments or processes.

Such comparative approaches can help position tspan31-b within the broader functional landscape of tetraspanin biology in Xenopus development.

What are common technical challenges when working with recombinant tspan31-b and how can they be addressed?

Researchers working with recombinant tspan31-b may encounter several technical challenges:

Additionally, when designing experiments, researchers should include appropriate controls such as non-specific tetraspanin controls to distinguish general tetraspanin effects from tspan31-b-specific functions.

How can researchers validate antibody specificity for distinguishing between tspan31-a and tspan31-b in Xenopus?

Validating antibody specificity for distinguishing between the homeologs tspan31-a and tspan31-b is critical for accurate research. Recommended approaches include:

• Western blot analysis using recombinant tspan31-a and tspan31-b proteins to confirm antibody specificity.

• Immunoprecipitation followed by mass spectrometry to confirm the identity of the precipitated protein.

• Immunostaining in knockdown/knockout models where either tspan31-a or tspan31-b has been depleted to confirm specificity.

• Peptide competition assays using unique peptide sequences from each homeolog to test antibody binding specificity.

• Heterologous expression systems expressing each homeolog individually to test antibody cross-reactivity.

• Epitope mapping to identify the specific regions recognized by antibodies and ensure they target divergent regions between the homeologs.

These validation steps should be performed and documented before using antibodies for critical experiments to ensure reliable detection and distinction between these closely related proteins.

What emerging technologies could advance our understanding of tspan31-b function in Xenopus development?

Several cutting-edge technologies hold promise for advancing our understanding of tspan31-b function:

• Single-cell RNA sequencing (scRNA-seq): To identify cell populations expressing tspan31-b at high resolution and track expression changes during development.

• Spatial transcriptomics: To map tspan31-b expression within tissue contexts while preserving spatial information.

• Optogenetics: To achieve temporal control over tspan31-b function in specific tissues or developmental stages.

• CRISPR-based lineage tracing: To track the fate of tspan31-b-expressing cells throughout development.

• Proximity labeling proteomics (BioID, APEX): To identify context-specific protein interaction networks in different tissues.

• Super-resolution microscopy: To visualize tetraspanin-enriched microdomains and their dynamics at nanoscale resolution.

• Organoid models: To study tspan31-b function in specific Xenopus organ systems in simplified in vitro contexts.

These approaches could provide unprecedented insights into the spatiotemporal dynamics of tspan31-b function during Xenopus development.

What are promising research questions regarding the potential role of tspan31-b in cellular signaling during development?

Based on current knowledge of tetraspanin biology and Xenopus development, several promising research questions emerge:

• Does tspan31-b regulate specific signaling pathways (Wnt, Notch, BMP, FGF) during Xenopus development by organizing receptor complexes in the membrane?

• How does tspan31-b contribute to "heterogeneity of intercellular communication" in specific tissues, and what are the developmental consequences?

• Does tspan31-b play a role in neural crest cell migration or differentiation, given the expression of tetraspanins in cranial and trunk neural crest cells?

• Is tspan31-b involved in eye development similar to cd63, which "is required for eye morphogenesis in Xenopus" ?

• How do tspan31-a and tspan31-b functionally interact during development, and has subfunctionalization occurred between these homeologs?

• What is the composition of tspan31-b-containing membrane microdomains, and how do they change during different developmental processes?

• Does tspan31-b play a role in exosome-mediated signaling during specific developmental transitions?

These questions represent fertile ground for future investigations that could significantly advance our understanding of tetraspanin biology in vertebrate development.