Recombinant Xenopus laevis Tetraspanin-33 (tspan33)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Xenopus laevis Tspan33 refers to the full-length or partial tetraspanin-33 protein expressed in heterologous systems (e.g., mammalian or insect cells) for experimental studies. Key production details include:

ParameterSpecification
Expression SystemMammalian cells (e.g., HEK293) or insect cells (e.g., Trichoplusia ni)
TagPolyhistidine (His) for purification and detection
Purity>80% (determined by SDS-PAGE)
Storage-20°C to -80°C in PBS buffer
Molecular FeaturesFull-length protein with conserved tetraspanin domains (4 transmembrane regions)

Domain Organization

  • Tetraspanin signature: A large extracellular loop (LEL) containing the CCG motif, critical for protein-protein interactions .

  • Disulfide bonds: Cysteine residues (e.g., C18 and C35 in homologs) mediate oligomerization, as shown in Xenopus intelectins .

Functional Roles

  • Cell adhesion and migration: Inferred from tetraspanin studies in Xenopus neural crest cells, where related tetraspanins (Tspan3, Tspan4) regulate motility .

  • Membrane dynamics: Potential modulation of plasma membrane tension, analogous to human TSPAN33’s role in B-cell migration .

Comparative Studies

  • Evolutionary conservation: Xenopus Tspan33 shares structural homology with human TSPAN33 (UniProt ID: Q96PX9), enabling cross-species functional analyses .

  • Ligand interaction assays: Recombinant Tspan33 could be used to study binding partners, similar to Xenopus intelectins tested for glycan interactions .

Disease Modeling

  • Notch signaling: Human Tspan33 regulates γ-secretase activity in Notch processing . Recombinant Xenopus Tspan33 may provide insights into developmental disorders linked to Notch dysregulation.

Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, as aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize fulfilling your request during production.
Synonyms
tspan33; Tetraspanin-33; Tspan-33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tspan33
Target Protein Sequence
MVRKSPGSGKEEDFTFISPVVKYLLIFFNMLFWVISMVMVGIGVYARLLKHAEAAMACLA VDPALLLIGVGILMFLITFCGCIGSLRENICLLQTFSICLTLVFLLQLAVGIVGFIFSDK ARGKVSEIISNAIEHYRDDLDLQNLIDFGQKEFSCCGGISYKDWSQNMYFNCSSENRSQE RCSVPYSCCLHDEGEAVINTLCGQGMQELDYLEAGEFIHTNGCIDRLVNWIHSNLFLLGG VALGLAIPQVTKHLRAKLIYTWRIGIQV
Uniprot No.

Target Background

Database Links

KEGG: xla:443880

UniGene: Xl.47220

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Xenopus laevis tspan33?

Xenopus laevis tspan33 (Uniprot NO.: Q6GQF5) is a 268-amino acid protein containing four transmembrane domains, two extracellular loops (one being cysteine-rich), and intracellular N- and C-termini. The full amino acid sequence includes characteristic tetraspanin features: MVRKSPGSGKEEDFTFISPVVKYLLIIFFNMLFWVISMVMVGIGVYARLLKHAEAAMACLAVDPALLLIGVGILMFLITFCGCIGSLRENICLLQTFSICLTLVFLLQLAVGIVGFIFSDKARGKVSEIISNAIEHYRDDLDLQNLIDFGQKEFSCCGGISYKDWSQNMYFNCSSENRSQERCSVPYSCCLHDEGEAVINTLCGQGMQELDYLEAGEFIHTNGCIDRLVNWIHSNLFLLGGVALGLAIPQVTKHLRAKLIYTWRIGIQV . This structure enables tspan33 to form tetraspanin-enriched microdomains that organize the plasma membrane.

What are the known functions of tetraspanins in Xenopus development?

Tetraspanins in Xenopus laevis serve as multipurpose adapters by forming "tetraspanin-enriched microdomains" that organize the plasma membrane . For example, Cd63, another tetraspanin family member, is required for proper eye morphogenesis in Xenopus. Knockdown of cd63 leads to impaired eye development with defects ranging from partial to nearly complete absence of retinal pigment epithelium (RPE), retina, and lens . Interestingly, while Cd63 localizes to melanosomes, it appears dispensable for melanophore specification and melanogenesis, highlighting the tissue-specific roles of tetraspanins in development.

What is the expression pattern of tspan33 during Xenopus development?

While specific tspan33 expression data in Xenopus is limited in the provided literature, related tetraspanins show dynamic expression patterns during development. For instance, Cd63 shows strong expression in premigratory trunk neural crest cells at early tailbud stages (stage 25) and later expands to the cement gland, head mesenchyme, brain, dermis, dorsal fin mesenchyme, migrating neural crest cells, and eyes including the retinal pigment epithelium (stage 30) . A comprehensive comparative analysis of Tspan3, Tspan4, Tspan5, and Tspan7 expression during X. laevis development has been conducted using quantitative real-time PCR and in situ hybridization , suggesting similar approaches could reveal tspan33-specific patterns.

How is tspan33 expression regulated during development?

Based on studies of other tetraspanins, expression regulation likely involves complex developmental signaling pathways. In human cells, TSPAN33 expression is regulated by NOTCH signaling, as its expression is diminished in macrophages lacking Notch1 and Notch2 but enhanced after overexpression of constitutively active intracellular domain of NOTCH1 . Additionally, human TSPAN33 expression increases in response to TLR signaling and is enhanced by IFN-γ . Similar regulatory mechanisms might control Xenopus tspan33 expression during development, though this requires experimental validation.

What methods are optimal for detecting tspan33 expression in Xenopus tissues?

To detect tspan33 expression in Xenopus tissues, researchers should employ:

MethodApplicationAdvantagesConsiderations
In situ hybridization (ISH)Spatial expression mappingReveals tissue-specific localizationRequires specific tspan33 RNA probe design
Quantitative RT-PCRTemporal expression analysisProvides quantitative measurementNeeds specific primers for Xenopus tspan33
ImmunohistochemistryProtein localizationReveals subcellular distributionRequires validated antibodies against Xenopus tspan33
Western blottingProtein expression levelsQuantifies protein abundanceMay use antibodies that cross-react with Xenopus tspan33

For RNA probe design, partial ISH probes can be cloned using standard RT-PCR with specific primers, as demonstrated for other Xenopus tetraspanins .

What strategies are effective for studying tspan33 function in Xenopus embryos?

To investigate tspan33 function in Xenopus embryos, researchers can employ the following approaches:

  • Morpholino-mediated knockdown: Design translation-blocking morpholino oligomers (TBMO) targeting the 5'UTR of both X. laevis homeologs of tspan33 mRNA. For example, with Cd63, a TBMO targeting the 5'UTR position -40 to -16 from the start codon was effective .

  • Rescue experiments: Co-inject wild-type tspan33 mRNA lacking the 5'UTR (morpholino-insensitive) with the TBMO to demonstrate specificity of observed phenotypes .

  • Targeted injections: Perform unilateral injections into specific blastomeres (e.g., one dorsal animal blastomere) to target tissues of interest while using the uninjected side as an internal control .

  • Marker gene analysis: Examine expression of tissue-specific markers (e.g., otx2 for eye development) to assess impact on tissue specification and morphogenesis .

  • CRISPR/Cas9 genome editing: Generate targeted mutations in tspan33 for more permanent genetic disruption.

How can recombinant Xenopus laevis tspan33 protein be produced and purified?

Recombinant Xenopus laevis tspan33 can be produced using expression systems suitable for membrane proteins. The commercially available recombinant protein is stored in Tris-based buffer with 50% glycerol optimized for protein stability . For laboratory production:

  • Clone the full-length tspan33 coding sequence (positions 1-268) into an appropriate expression vector.

  • Express in systems like E. coli, insect cells, or mammalian cells (HEK293 cells may be preferable for proper folding and post-translational modifications).

  • Add an affinity tag (His, GST, or customized tag) determined during the production process to facilitate purification .

  • Purify using affinity chromatography followed by size exclusion chromatography.

  • Store in Tris-based buffer with 50% glycerol at -20°C for extended storage, with working aliquots at 4°C for up to one week .

Avoid repeated freezing and thawing, as this can compromise protein activity.

What phenotypes might result from tspan33 manipulation in Xenopus embryos?

Based on studies of other tetraspanin family members, potential phenotypes from tspan33 manipulation might include:

  • Developmental defects: If expressed in neural tissues, eye formation defects similar to those observed with Cd63 knockdown might occur .

  • Cell migration abnormalities: Given the role of tetraspanins in cell adhesion and migration, defects in neural crest cell migration or other migratory cell populations could be observed .

  • Immune system defects: Human TSPAN33 modulates TLR-induced proinflammatory gene expression in macrophages , suggesting potential immune system phenotypes in Xenopus.

  • B-cell abnormalities: Human TSPAN33 regulates endocytosis and migration of B lymphocytes , indicating possible defects in Xenopus B-cell development or function.

  • NOTCH signaling disruption: Given TSPAN33's role in NOTCH processing in human cells , developmental processes dependent on NOTCH signaling might be affected.

How can genetic code expansion be implemented to study tspan33 in Xenopus?

Genetic code expansion provides a powerful approach for incorporating novel chemical functionalities into tspan33 in Xenopus embryos. This method involves:

  • System establishment: Inject PylRS mRNA (250 pg), tspan33-UAG mRNA (250 pg containing an amber stop codon at the position of interest), and PylT (7.5 ng) into one-cell stage Xenopus embryos .

  • Unnatural amino acid incorporation: Include the desired unnatural amino acid (UAA) at 10-50 mM in the injection solution (at least 50 pmol total) .

  • Chemical functionality options:

    • Alloc-protected lysine for protection/deprotection studies

    • Photo-crosslinking amino acids to capture tspan33 interaction partners

    • Click chemistry-compatible amino acids for in vivo labeling

    • Caged amino acids that can be activated with tetrazines for temporal control

  • Activation strategies: For caged variants, incubate embryos with tetrazine derivatives (e.g., 100 μM for 1-2 hours) to trigger decaging reactions .

This approach allows site-specific modification of tspan33 for various functional studies, including visualization, interaction mapping, and temporal regulation of activity.

How does TSPAN33 regulate membrane dynamics and cellular processes?

In human B lymphocytes, TSPAN33 regulates plasma membrane tension and cytoskeletal organization , suggesting similar functions might exist in Xenopus. TSPAN33:

  • Inhibits changes in roughness and membrane tension during fibronectin-induced cell spreading .

  • Affects protrusion formation, adhesion, phagocytosis, and cell motility .

  • Localizes to specific subcellular structures including membrane microvilli, Golgi apparatus, and extracellular vesicles .

  • Modulates expression of adhesion molecules, particularly integrins, altering cell adhesion properties .

  • Enhances migratory phenotypes, with augmented chemotaxis and invasion rates when overexpressed .

These findings suggest tspan33 may play critical roles in regulating cellular behaviors through modulation of membrane mechanics and organization in Xenopus cells.

What is the relationship between tspan33 and NOTCH signaling in development?

Based on findings in mammalian systems, tspan33 may regulate NOTCH signaling during Xenopus development through several mechanisms:

  • ADAM10 regulation: TSPAN33 is a member of the TspanC8 tetraspanin subgroup that regulates ADAM10 maturation . In activated macrophages, TSPAN33 overexpression increases ADAM10 (but not ADAM17) maturation.

  • NOTCH processing facilitation: TSPAN33 favors NOTCH processing at the membrane by modulating ADAM10 and/or Presenilin1 activity, thus increasing NOTCH signaling .

  • Transcriptional effects: TSPAN33 modulates TLR-induced proinflammatory gene expression, partly by increasing NF-κB-dependent transcriptional activity .

  • Feedback regulation: TSPAN33 expression is itself regulated by NOTCH signaling, creating a potential feedback loop .

These interactions suggest tspan33 could play important roles in developmental processes controlled by NOTCH signaling in Xenopus, such as neurogenesis, somitogenesis, and angiogenesis.

How can Xenopus tspan33 studies inform human disease mechanisms?

Studies of tspan33 in Xenopus can provide valuable insights into human disease mechanisms given that:

  • Tetraspanins that first appeared in vertebrates are highly conserved across species .

  • Human TSPAN33 is implicated in several diseases, including:

    • Lymphomas (Hodgkin's and Diffuse large B cell lymphoma)

    • Autoimmune diseases with B cell pathology

    • Erythropoiesis disorders (TSPAN33 plays important roles in normal erythropoiesis and differentiation of erythroid progenitors)

  • The external development and experimental accessibility of Xenopus embryos make it an excellent model for studying developmental processes that may be disrupted in human diseases.

  • Functional conservation between species allows for testing whether human disease-associated variants of TSPAN33 can rescue phenotypes in Xenopus models.

What techniques can be used to perform cross-species functional studies of tspan33?

For comparative functional analysis across species, researchers can employ:

TechniqueApplicationExample
Cross-species rescueDetermine functional conservationCo-inject human TSPAN33 mRNA with Xenopus tspan33 morpholino
Domain swappingIdentify critical functional regionsCreate chimeric proteins with domains from human and Xenopus tspan33
Heterologous expressionStudy protein in different cellular contextsExpress Xenopus tspan33 in human cell lines (e.g., B cells)
Antibody cross-reactivityUse tools across speciesTest human TSPAN33 antibodies on Xenopus tissues
Interactome comparisonIdentify conserved binding partnersPull-down experiments comparing Xenopus and human tspan33
CRISPR/Cas9 editingGenerate equivalent mutationsCreate matching mutations in both species to compare phenotypes

These approaches leverage the evolutionary conservation of tetraspanins to translate findings between model systems and human biology.

How do the functions of tspan33 compare with other tetraspanin family members in development?

The tetraspanin family in Xenopus shows diverse functions during development:

  • Cd63: Required for eye morphogenesis but dispensable for melanophore specification and melanogenesis . Localizes to early melanosomes and is enriched in intraluminal vesicles of late endosomes.

  • Tspan3, Tspan4, Tspan5, Tspan7: These related tetraspanins show specific spatial and temporal expression patterns during Xenopus development . In humans, they are associated with diseases such as sclerosis, mental retardation, and cancer.

  • Tspan33: While specific developmental functions in Xenopus remain to be fully characterized, based on human studies, it likely plays roles in immune cell function , cell migration , and potentially erythropoiesis .

This family of proteins appears to have undergone functional specialization while maintaining core structural features, allowing them to regulate diverse developmental and physiological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.