Recombinant Xenopus laevis TM2 domain-containing protein 2 (tm2d2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tm2d2; TM2 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-198
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
tm2d2
Target Protein Sequence
QNNTSPVTYPDINVSAAPEPRDPLGPLVLCSYLPEEFVECDDPVDHMGNGTAQQELRYGC KKFGGQAYGDVEHTQVMCRALDGIECDGSRSFLRGNRPCIKYTGHYFITTLLYSFFLGCF GVDRFCLGHTGTAVGKLLTWGGLGIWWFVDLILLITGGLMPSDNSNWCTIY
Uniprot No.

Target Background

Database Links

KEGG: xla:495160

UniGene: Xl.54741

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the TM2 domain and what are its key structural features in Xenopus laevis proteins?

The TM2 domain represents the second transmembrane segment found in various membrane proteins, typically forming an α-helical structure that spans the lipid bilayer. In Xenopus laevis transmembrane proteins, TM2 domains generally consist of 20-22 amino acids that contribute to the α-helical conformation. Key structural features include:

  • A predominance of hydrophobic residues that interact with the lipid bilayer

  • Strategically positioned polar residues (such as threonine) that can participate in hydrogen bonding

  • Conserved leucine residues that often mediate protein-protein or protein-ligand interactions through hydrophobic contacts

  • A distinct spatial arrangement where specific residues face the protein interior while others face the lipid environment

Similar to TM2 domains in other species, the Xenopus laevis TM2 domains contain amino acid triplets that can form specific recognition sites for ligands or other regulatory molecules .

How is the recombinant Xenopus laevis TM2 domain-containing protein 2 typically expressed for research purposes?

Recombinant expression of Xenopus laevis TM2 domain-containing proteins typically employs the following methodology:

  • cDNA cloning from Xenopus laevis tissue samples using PCR amplification with specific primers

  • Insertion of the cDNA into an appropriate expression vector (commonly pOX for Xenopus oocyte expression)

  • In vitro transcription to generate cRNA from linearized plasmid DNA

  • Quality control of cRNA through gel electrophoresis and spectrophotometric quantification

  • Dissolving purified cRNA in diethyl polycarbonate-treated water at appropriate concentrations (10-30 ng/μL)

  • Storage of cRNA aliquots at -70°C until use

The preferred heterologous expression system is often Xenopus laevis oocytes themselves, which provides a native-like environment for proper folding and function of Xenopus proteins. The interval between cRNA cytosolic injection and functional characterization is typically 36-48 hours to allow for robust protein expression .

What advantages does the Xenopus laevis expression system offer for studying TM2 domain-containing proteins?

The Xenopus laevis expression system offers several significant advantages for studying TM2 domain-containing proteins:

  • Native-like post-translational processing of Xenopus proteins

  • High expression levels of functional membrane proteins

  • Large oocyte size (1-1.2 mm) that facilitates microinjection and subsequent electrophysiological recording

  • Minimal endogenous channel expression, providing a clean background for functional studies

  • The cellular machinery for proper protein folding and membrane insertion

  • Ability to express both wild-type and mutated versions of TM2 domain-containing proteins

  • Feasibility of co-expressing multiple protein components to study complex interactions

These advantages make the Xenopus system particularly valuable for structure-function studies of TM2 domain-containing proteins, especially when examining how specific amino acid residues contribute to protein function or ligand interactions .

What computational modeling approaches are most effective for predicting interactions between ligands and TM2 domains in Xenopus proteins?

For studying ligand interactions with TM2 domains in Xenopus proteins, several computational approaches have proven effective:

  • Molecular Dynamics (MD) Simulations:

    • Allow visualization of dynamic interactions over time

    • Can reveal transient binding events and conformational changes

    • Provide quantitative measurements of bond distances and stability

  • Homology Modeling (particularly useful for TM2d2):

    • Builds structural models based on related proteins with known structures

    • Identifies potential ligand binding pockets

    • Can be combined with docking studies

  • Docking Simulations:

    • Predict preferred orientation of ligands within binding pockets

    • Calculate binding energies to rank potential interaction sites

In studies of TM2 domains, MD simulations have been particularly valuable for measuring critical parameters such as the distance between ligand hydroxyl groups and protein polar residues, as well as distances between hydrophobic moieties and nonpolar amino acids. The following table illustrates typical measurements obtained from MD simulations of TM2 domain-ligand interactions:

ConstructDistance Between Ligand Hydroxyl and TM2 Polar Residue (Å)Distance Between Hydrophobic Ligand Region and Nonpolar TM2 Residue (Å)
Wild-type TM22.98 ± 0.602.45 ± 0.29
TM2 Polar Residue Mutant4.10 ± 1.025.13 ± 1.66
TM2 Nonpolar Residue Mutant4.50 ± 1.355.38 ± 2.43

These computational approaches should be validated through experimental methods such as site-directed mutagenesis and functional assays .

How can site-directed mutagenesis be optimized to investigate the functional significance of specific residues in TM2 domains?

Optimizing site-directed mutagenesis for TM2 domain studies requires strategic planning:

For example, in studies of TM2 domain-containing proteins, researchers have systematically replaced threonine and leucine residues with alanine to test their role in ligand sensing, confirming that the mutated proteins were still properly expressed and folded before concluding that specific residues were critical for ligand interactions .

What are the challenges in distinguishing the roles of individual amino acids in TM2 domains that contribute to protein-ligand interactions?

Researchers face several significant challenges when attempting to pinpoint the roles of specific amino acids in TM2 domains:

  • Cooperative Effects:

    • Multiple residues often work together in ligand recognition

    • Mutation of a single residue may show minimal effects if other residues compensate

    • For example, in TM2 domains, pairs of leucine residues often work together to create hydrophobic interaction surfaces

  • Indirect Structural Effects:

    • Mutations can alter the orientation of neighboring residues

    • Changes in side chain volume may reposition the entire helix

    • Distinguishing direct ligand interactions from structural perturbations requires careful control experiments

  • Context-Dependent Functions:

    • The same amino acid may play different roles depending on its environment

    • Interactions with other protein domains may influence ligand binding

    • Lipid environment can affect accessibility of TM2 residues

  • Quantifying Weak Interactions:

    • Hydrophobic interactions and hydrogen bonds may have subtle energetic contributions

    • Multiple weak interactions may collectively create high-affinity binding

    • Small changes in bond distances (0.5-1.0 Å) can significantly impact function

For example, in studies of TM2 domains involved in steroid recognition, researchers found that substitution of a single threonine with serine (maintaining the hydroxyl group) still disrupted function because it altered the precise positioning of the hydrogen bonding partner, increasing the distance from the ligand hydroxyl group from ~3.0 Å to ~4.1 Å .

How can molecular dynamics simulations complement experimental data in the study of TM2 domain-containing proteins?

Molecular dynamics (MD) simulations provide valuable insights that complement experimental approaches in several ways:

  • Detailed Interaction Visualization:

    • MD simulations reveal atomic-level details of protein-ligand interactions

    • Bond distances can be measured with precision

    • Temporal dynamics of interactions can be analyzed

  • Hypothesis Generation and Testing:

    • Simulations can predict effects of mutations before experimental testing

    • Multiple potential binding modes can be screened efficiently

    • Unexpected interactions may be discovered that weren't initially hypothesized

  • Mechanism Elucidation:

    • Simulations can reveal the sequence of events in ligand binding and protein activation

    • Conformational changes following ligand binding can be observed

    • Allosteric effects can be identified that may be difficult to detect experimentally

  • Resolving Experimental Inconsistencies:

    • When experimental results are ambiguous, simulations can suggest alternative interpretations

    • The physical basis for functional changes observed in mutagenesis studies can be clarified

For instance, MD simulations of TM2 domains interacting with ligands have revealed that mutations can increase the distance between critical interaction points, explaining loss of function even when chemical properties are largely maintained. The standard deviations in these measurements also provide insight into the stability of interactions, with wild-type proteins typically showing smaller standard deviations (±0.3 Å) compared to mutants (±2.0 Å or greater) .

What protocols optimize the preparation and microinjection of cRNA for TM2 domain-containing proteins into Xenopus laevis oocytes?

Optimal protocols for cRNA preparation and microinjection include:

  • cRNA Preparation:

    • Start with high-quality cDNA clones in appropriate vectors (e.g., pOX)

    • Linearize plasmid DNA with appropriate restriction enzyme downstream of the insert

    • Perform in vitro transcription using T7, T3, or SP6 RNA polymerase depending on vector

    • Include 5' cap analog and poly(A) tail for mRNA stability

    • Purify cRNA using lithium chloride precipitation or commercial columns

    • Verify cRNA integrity by agarose gel electrophoresis

    • Quantify cRNA concentration using spectrophotometry

    • Dissolve cRNA in diethyl polycarbonate-treated water at appropriate concentrations (10-30 ng/μL)

    • Store 1-μL aliquots at -70°C to prevent degradation

  • Oocyte Preparation:

    • Surgically harvest oocytes from Xenopus laevis females

    • Defolliculate oocytes using collagenase treatment

    • Select stage VI oocytes (1.1-1.3 mm diameter) for optimal expression

    • Maintain oocytes in appropriate medium with antibiotics

  • Microinjection Technique:

    • Pull glass micropipettes to achieve tip diameter of 10-30 μm

    • Fill pipettes with mineral oil and then load cRNA sample

    • Inject 50-100 nL of cRNA solution

    • For co-expression studies, mix cRNAs prior to injection

    • Maintain consistent injection volume using calibrated systems

  • Post-Injection Care:

    • Incubate oocytes at lower temperature (16-18°C) to optimize protein expression

    • Allow 36-48 hours for robust protein expression

    • Regularly change incubation medium and remove damaged oocytes

These protocols have been successfully employed for expressing TM2 domain-containing proteins in Xenopus oocytes, resulting in functional proteins suitable for characterization .

How can overlap-extension PCR be effectively used to introduce targeted mutations into TM2 domains?

Overlap-extension PCR is a powerful technique for site-directed mutagenesis in TM2 domains:

  • Primer Design Strategy:

    • Design four primers total: two flanking primers (F1 and R2) and two mutagenic primers (R1 and F2)

    • Mutagenic primers should:

      • Contain the desired mutation in the middle of the sequence

      • Have 15-20 complementary nucleotides on each side of the mutation

      • Maintain a GC content of 40-60%

      • Have similar melting temperatures

    • Flanking primers should include appropriate restriction sites for subsequent cloning

  • Two-Step PCR Process:

    • First PCR reactions:

      • Reaction 1: F1 + R1 to amplify the 5' fragment with mutation at 3' end

      • Reaction 2: F2 + R2 to amplify the 3' fragment with mutation at 5' end

    • Purify both PCR products using gel extraction

    • Second PCR reaction:

      • Mix both purified fragments as templates

      • Use only flanking primers (F1 + R2)

      • The overlapping regions (containing the mutation) will anneal and extend

  • Optimization Tips:

    • Use high-fidelity DNA polymerase (e.g., Pfu) to minimize errors

    • Adjust annealing temperatures based on primer melting temperatures

    • Use longer extension times for TM2 domain fragments

    • Consider adding DMSO (5-10%) for GC-rich regions

  • Verification and Cloning:

    • Digest final PCR product with appropriate restriction enzymes

    • Ligate into expression vector (e.g., pOX for Xenopus expression)

    • Transform into competent E. coli

    • Screen colonies by restriction digestion or colony PCR

    • Perform DNA sequencing to confirm the presence of the desired mutation and absence of unwanted mutations

This approach has been successfully used to create multiple TM2 domain mutations, including single substitutions and double mutations, allowing systematic investigation of residues involved in protein function .

What are the key considerations when designing experiments to study ligand interactions with TM2 domains using Xenopus expression systems?

Designing effective experiments to study ligand-TM2 domain interactions requires careful planning:

  • Experimental Controls:

    • Positive controls: Wild-type proteins with known ligand responses

    • Negative controls:

      • Proteins lacking the TM2 domain

      • Proteins with mutations known to abolish ligand sensitivity

    • Internal controls: Verify that mutated proteins maintain other functional properties

  • Expression System Optimization:

    • Adjust cRNA concentrations to achieve consistent expression levels

    • For multi-subunit proteins, optimize subunit ratios to ensure proper assembly

    • Allow sufficient time (36-48 hours) for robust protein expression

    • Verify functional expression before ligand application

  • Ligand Delivery Considerations:

    • Prepare ligand stocks in appropriate solvents (considering solubility issues)

    • Control for solvent effects by including vehicle controls

    • Use concentration ranges that span the expected EC50

    • Consider ligand solubility in aqueous solutions (particularly for hydrophobic compounds)

    • Allow sufficient time for ligand equilibration

  • Data Collection and Analysis:

    • Establish clear parameters for quantifying ligand effects

    • Construct complete concentration-response relationships when possible

    • Determine key pharmacological parameters (EC50, Emax, Hill coefficient)

    • Apply appropriate statistical tests to compare wild-type and mutant responses

  • Comprehensive Mutagenesis Strategy:

    • Use both conservative and non-conservative mutations

    • Test individual residues and combinations to identify cooperative effects

    • Consider the three-dimensional context of residues based on computational models

These considerations enable researchers to systematically investigate the structural basis of ligand interactions with TM2 domains, as demonstrated in studies where specific mutations abolished ligand sensitivity while others had minimal effects .

How can researchers effectively combine computational modeling and site-directed mutagenesis to identify key residues in TM2 domains?

An integrated approach combining computational modeling and mutagenesis provides powerful insights into TM2 domain function:

  • Iterative Research Workflow:

    • Initial computational modeling based on homology or available structures

    • Generation of testable hypotheses about key interacting residues

    • Experimental validation through site-directed mutagenesis

    • Refinement of computational models based on experimental results

    • Development of second-generation hypotheses for further testing

  • Strategic Integration Points:

    • Use computational models to prioritize residues for mutagenesis

    • Employ experimental results to validate and refine computational parameters

    • Interpret unexpected experimental outcomes using computational simulations

    • Address discrepancies between computational predictions and experimental results

  • Specific Techniques and Measurements:

    • Measure key parameters in both computational models and functional assays:

      • Bond distances (computational)

      • Binding energies (computational)

      • Functional responses (experimental)

      • EC50 values (experimental)

    • Correlate structural predictions with functional outcomes

For example, in studies of TM2 domain-containing proteins, researchers have used computational modeling to identify potential binding sites, followed by systematic mutagenesis to test the functional importance of each site. Molecular dynamics simulations can then measure bond distances in wild-type and mutant constructs, revealing specific chemical interactions such as hydrogen bonding by threonine residues and hydrophobic contacts by leucine residues .

What controls should be implemented when studying the effects of mutations in TM2 domains on protein function?

Rigorous controls are essential when interpreting the effects of TM2 domain mutations:

  • Expression Controls:

    • Verify similar expression levels between wild-type and mutant proteins

    • For membrane proteins, confirm proper membrane targeting and insertion

    • Use epitope tags or fluorescent fusion proteins if antibodies against the native protein are unavailable

  • Functional Integrity Controls:

    • Verify that mutated proteins maintain other functional properties

    • For channel proteins, confirm:

      • Basic channel properties (conductance, ion selectivity)

      • Voltage sensitivity (if voltage-gated)

      • Response to well-characterized modulators unrelated to the pathway being studied

  • Specificity Controls:

    • Include mutations predicted to have no effect on the studied interaction

    • Test multiple concentrations of ligands to distinguish shifts in affinity from complete loss of sensitivity

    • For channel proteins, examine multiple parameters (e.g., activation kinetics, open probability)

  • Structure-Function Relationship Controls:

    • Use conservative mutations that preserve certain chemical properties

    • Compare effects of mutations at nearby residues to establish specificity

    • Examine potential cooperative effects with double or triple mutations

  • Rescue Experiments:

    • When possible, attempt to rescue mutant phenotypes with modified ligands or conditions

    • For example, if a mutation disrupts a hydrogen bond, test if higher ligand concentrations can overcome the reduced affinity

By implementing these controls, researchers can confidently attribute observed functional changes to specific molecular interactions disrupted by mutations, rather than to global effects on protein structure or expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.