Recombinant Xenopus laevis TM2 domain-containing protein 3 (tm2d3)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xenopus laevis TM2 domain-containing protein 3 (tm2d3) is a protein related to human TM2D3, which is encoded by the TM2D3 gene . TM2D3 is one of three highly conserved TM2 domain containing (TM2D) proteins encoded in the human genome . The two other TM2 domain-containing proteins, TM2D1 and TM2D2 share a similar protein domain structure with TM2D3, and each protein is encoded by a highly conserved orthologous gene in Drosophila that have not been functionally characterized . All TM2D proteins have a predicted N-terminal signal sequence and two transmembrane domains that are connected through a short intracellular loop . Within this loop, there is an evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif, a sequence found in some G-protein coupled receptors that mediates their conformational change upon ligand binding .

Structure and Function

TM2D3 shares structural similarities with other TM2D proteins, featuring conserved transmembrane domains and an intracellular loop with a DRF motif . TM2D3's function has been linked to Notch signaling, a crucial pathway in development and cell fate determination .

Association with Alzheimer's Disease

Rare variants in TM2D3 have been associated with late-onset Alzheimer's disease (LOAD) . One such variant, p.P155L, has been linked to an increased risk of developing LOAD .

Functional Studies

Functional studies have explored the role of TM2D3 in various organisms, including Drosophila . For example, the Drosophila ortholog of TM2D3, almondex (amx), is required for embryonic Notch signaling . Studies in Drosophila have shown that loss of amx causes a reduction in lifespan, and this can be weakly suppressed by human TM2D3 .

TM2D3 and Notch Signaling

TM2D3 has been shown to activate Notch1, suggesting its involvement in the Notch signaling pathway . TM2D3 proteins localized in small vesicular structures distributed within the cytoplasm .

Genetic Association Studies

CohortGroupNo (% women)Age, mean (SD), yearAPOE ε4+ No (%)TM2D3 carriers, No (%)p (OR, 95% CI) ap Fisher’s Exact bp conditional c
AGES-discoveryCases143 (59)82.5 (4.9)66 (46)7 (4.9)5.9x10-8 (8.62, 3.43–21.68)5.6x10-48.4x10-8
Controls2374 (59)78.9 (5.0)638 (27)20 (0.8)
AGES-followupCases290 (59)84.5 (5.1)127 (44)6 (2.1)3.0x10-3 (5.42, 1.60–18.32)6.2x10-31.1x10-2

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion in the production process.

Synonyms
tm2d3; TM2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-247
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
FEYSQPVAQPLKDTFPSSTTATSIKATTTKMPEYMEICPSNGQCSRLASDCMTCATNYSC IYGKLVTFNCTAKNGVVCFDENSQRQEYFTISMACQFCWQLPPSDYVCNLSSSCKTISCP RQRYNTTCTVLDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR EGLGKLFSFGGLGIWTLIDVFLISVGYVGPADGSLYI
Uniprot No.

Target Background

Database Links

KEGG: xla:446547

UniGene: Xl.53470

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TM2D3 and what is its general structure?

TM2D3 (TM2 domain-containing protein 3) is one of three highly conserved TM2 domain-containing proteins encoded in metazoan genomes. The protein has a characteristic structure featuring a predicted N-terminal signal sequence and two transmembrane domains connected through a short intracellular loop. This loop contains an evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif, a sequence found in some G-protein coupled receptors that mediates conformational changes upon ligand binding. TM2D3 also has a short C-terminal extracellular tail that is evolutionarily conserved but differs from its paralogs TM2D1 and TM2D2 .

How conserved is TM2D3 across species?

TM2D3 is highly conserved across metazoan species. Each species typically encodes three separate TM2D genes. The intracellular loop and transmembrane domains show particularly high conservation throughout evolution, while the extracellular region between the signal sequence and first transmembrane domain is more divergent. Functional studies have demonstrated that human TM2D3 can partially rescue phenotypes in Drosophila TM2D3 (almondex) mutants, suggesting that the function of this protein family is evolutionarily conserved .

What are the known biological functions of TM2D3?

Based on studies across multiple model organisms, TM2D3 appears to function in several key biological processes:

  • Notch signaling: In Drosophila, loss of the TM2D3 ortholog almondex (amx) causes maternal-effect neurogenic defects due to disrupted Notch signaling during embryonic development.

  • Neural function: Loss of amx in Drosophila causes age-dependent decline in neuronal function and reduced lifespan.

  • Potential role in phagocytosis: CRISPR-based screens in mammalian cells have identified all three TM2D genes as regulators of phagocytosis.

  • Disease association: Rare variants in TM2D3 are associated with late-onset Alzheimer's disease (LOAD), suggesting a potential role in neurodegenerative processes .

How do TM2D protein family members interact functionally?

The three TM2D proteins (TM2D1, TM2D2, and TM2D3) appear to function together in various biological contexts. In Drosophila, knockout of any one of the three TM2D genes produces similar maternal-effect neurogenic phenotypes. Interestingly, triple knockout of all TM2D genes does not exacerbate these phenotypes compared to single knockouts, suggesting these genes function in the same pathway or complex. This functional relationship is supported by proteomics data from human cells that has detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, indicating they may form a protein complex. Further biochemical studies are needed to fully elucidate the functional relationship between these three proteins .

What is the relationship between TM2D3 and neurodegenerative disorders?

Rare variants in TM2D3, particularly P155L, have been associated with increased risk and earlier onset of late-onset Alzheimer's disease (LOAD). This variant is enriched in the Icelandic population (~0.5% versus <0.05% in other European populations) and shows strong disease association (odds ratio = 7.5, p = 6.6×10-9). Functional studies in Drosophila demonstrated that the P155L mutation abolishes the ability of human TM2D3 to rescue almondex mutant phenotypes, establishing it as a functionally damaging allele. TM2D3 also shares homology with β-amyloid peptide binding protein (BBP or TM2D1), suggesting potential involvement in β-amyloid-related pathways relevant to Alzheimer's disease .

How does TM2D3 function within the Notch signaling pathway?

Studies in Drosophila suggest that TM2D3 (Amx) functions at the level of γ-secretase to modulate Notch signaling in vivo. Overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling specifically at the γ-secretase cleavage step. The maternal-effect neurogenic phenotype observed in TM2D knockout flies results when Notch signaling-mediated lateral inhibition is disrupted during cell-fate decisions in the developing ectoderm. This neurogenic phenotype is characterized by expansion of the nervous system at the expense of the epidermis, a hallmark of Notch signaling defects .

What approaches can be used to express and purify recombinant Xenopus laevis TM2D3?

For expressing recombinant Xenopus laevis TM2D3, researchers may consider:

  • Expression System Selection:

    • Bacterial systems (E. coli): Cost-effective but may be challenging for transmembrane proteins

    • Eukaryotic systems: Insect cells (baculovirus) or mammalian cell lines (HEK293, CHO) typically provide better folding and post-translational modifications for transmembrane proteins

  • Construct Design:

    • Include affinity tags (His, FLAG, or GST) for purification

    • Consider truncating the protein to remove transmembrane domains for soluble expression

    • Codon optimization for the chosen expression system

  • Purification Strategy:

    • For full-length protein: Detergent-based extraction (CHAPS, DDM, or Triton X-100)

    • For soluble domains: Standard chromatography techniques

    • Affinity chromatography followed by size exclusion chromatography

  • Quality Control:

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Circular dichroism to assess secondary structure

How can researchers study TM2D3 function in Xenopus embryos?

Several approaches can be employed to study TM2D3 function in Xenopus embryos:

  • Loss-of-function approaches:

    • Morpholino oligonucleotides to knockdown endogenous TM2D3

    • CRISPR/Cas9-mediated knockout

    • Dominant-negative constructs based on conserved domains

  • Gain-of-function approaches:

    • mRNA injection of wild-type or mutant TM2D3

    • Transgenic expression under tissue-specific promoters

  • Functional readouts:

    • Analysis of Notch signaling targets by qPCR or in situ hybridization

    • Assessment of neurogenesis patterns using neural markers

    • Electrophysiological measurements in older tadpoles

  • Cross-species rescue experiments:

    • Testing if human TM2D3 can rescue Xenopus TM2D3 knockdown phenotypes

    • Testing disease-associated variants (e.g., P155L) for rescue efficiency

What techniques are available for analyzing TM2D3 expression patterns in Xenopus laevis?

Researchers can utilize several techniques to analyze TM2D3 expression:

  • Transcriptional profiling:

    • RNA-Seq of whole embryos or tissues at different developmental stages

    • Quantitative PCR for stage-specific expression

    • In situ hybridization for spatial expression patterns

  • Protein detection:

    • Western blotting with TM2D3-specific antibodies

    • Immunohistochemistry for tissue localization

    • Fluorescent protein fusions for live imaging

  • Xenopus databases:

    • Searchable RNA-Seq expression profile databases specific to Xenopus

    • Resources like Xenbase for comparing expression across developmental stages

  • Subgenome-specific analysis:

    • Since X. laevis is allotetraploid (arose from hybridization of two species), distinguishing between expression from homeologous genes in the L and S subgenomes is important for comprehensive analysis

How should researchers address the allotetraploid nature of Xenopus laevis when studying TM2D3?

Xenopus laevis arose from hybridization of two different frog species millions of years ago, resulting in an allotetraploid genome with two subgenomes (L and S). When studying TM2D3 in X. laevis, researchers should:

  • Gene identification and annotation:

    • Identify both homeologs of TM2D3 (typically designated TM2D3.L and TM2D3.S)

    • Design primers or probes that can distinguish between the two homeologs

  • Expression analysis:

    • Quantify expression from each subgenome separately

    • Consider that the two homeologs may have different expression patterns or levels

  • Functional analysis:

    • Design knockout or knockdown strategies that target each homeolog specifically or both simultaneously

    • Consider potential functional redundancy or divergence between homeologs

  • Data interpretation:

    • Remember that combined transcriptional output from both homeologs often converges to proportionally resemble the diploid state, maintaining gene dosage for important developmental programs

What are the key considerations when comparing TM2D3 function across different model organisms?

When comparing TM2D3 function across species, researchers should consider:

  • Evolutionary conservation and divergence:

    • Highly conserved domains likely maintain similar functions

    • Species-specific domains may confer unique functions

  • Developmental context:

    • Different model organisms may utilize TM2D3 in different developmental programs

    • Timing of expression may vary significantly

  • Compensatory mechanisms:

    • The presence of other TM2D family members may provide functional redundancy

    • The degree of redundancy may differ between species

  • Experimental readouts:

    • Equivalent phenotypic readouts should be established across species

    • For example, neurogenic phenotypes in Drosophila versus Xenopus require different markers and analysis methods

  • Rescue experiments:

    • Cross-species rescue experiments provide strong evidence for functional conservation

    • Partial rescue may indicate both conserved and divergent functions

How can researchers address contradictory findings in TM2D3 functional studies?

When encountering contradictory findings about TM2D3 function, consider:

  • Context-dependent functions:

    • TM2D3 may function differently in embryonic versus adult tissues

    • Cell type-specific roles might explain apparently contradictory findings

  • Technical considerations:

    • Different knockout/knockdown approaches may have varying efficiencies or off-target effects

    • Antibody specificity issues might lead to contradictory localization results

  • Systematic validation approach:

    • Use multiple independent methods to confirm findings

    • Perform rescue experiments to verify specificity of observed phenotypes

    • Test different developmental stages and tissues

  • Collaboration with specialized labs:

    • Engage with laboratories that have expertise in specific aspects of TM2D3 biology

    • Replicate key findings across different research groups

What are the structural and functional differences between TM2D3 and other TM2D family proteins?

The TM2D protein family includes TM2D1, TM2D2, and TM2D3, which share similar core structures but differ in specific domains:

FeatureTM2D1TM2D2TM2D3
Transmembrane domains222
DRF motifPresentPresentPresent
C-terminal tail lengthLongerIntermediateShorter
Extracellular regionDivergentDivergentDivergent
Known interactionsβ-amyloid peptide bindingLess characterizedγ-secretase/Notch pathway
Disease associationsPotential AD linkLimited dataLOAD (P155L variant)

While genetic studies in Drosophila suggest functional overlap (similar neurogenic phenotypes when any one is knocked out), the specific biochemical functions of each family member likely differ based on their unique structural elements and interaction partners .

How do expression patterns of TM2D family members compare in Xenopus development?

While comprehensive comparative expression data specific to Xenopus laevis is limited in the provided search results, general patterns can be inferred from evolutionary conservation and available RNA-Seq databases:

  • Temporal expression:

    • RNA-Seq databases for Xenopus development can be consulted to determine stage-specific expression of TM2D1, TM2D2, and TM2D3

    • Expression patterns during maternal-to-zygotic transition may be particularly relevant

  • Spatial expression:

    • Neural tissues likely express all three family members based on their roles in other organisms

    • Tissue-specific expression differences may indicate specialized functions

  • Homeolog expression:

    • For each TM2D family member, expression of both L and S homeologs should be analyzed

    • Differential regulation of homeologs might suggest subfunctionalization

  • Relative abundance:

    • Quantitative comparison of expression levels between the three family members

    • Potential compensation mechanisms if one member is knocked down

What are promising research directions for studying TM2D3 in Xenopus laevis neurodegeneration models?

Given the connection between TM2D3 variants and Alzheimer's disease, Xenopus models offer several promising research avenues:

  • Modeling human variants:

    • Generate transgenic Xenopus expressing human TM2D3 variants (e.g., P155L)

    • Study long-term neural function and survival in these models

  • Amyloid interaction studies:

    • Investigate potential interactions between TM2D3 and amyloid processing machinery

    • Test if TM2D3 modulates amyloid toxicity in Xenopus neurons

  • Age-dependent phenotypes:

    • Characterize age-dependent electrophysiological changes in TM2D3-deficient Xenopus

    • Study lifespan effects similar to those observed in Drosophila

  • γ-secretase modulation:

    • Explore how TM2D3 interacts with and modulates γ-secretase activity

    • Investigate effects on both Notch and APP processing

  • Therapeutic targets:

    • Screen for small molecules that modify TM2D3 function

    • Test neuroprotective strategies in TM2D3 variant models

How might CRISPR/Cas9 genome editing advance TM2D3 research in Xenopus?

CRISPR/Cas9 technology offers powerful approaches for studying TM2D3 in Xenopus:

  • Precise gene knockout:

    • Generate complete loss-of-function models for TM2D3

    • Create double or triple knockouts of all TM2D family members

  • Subgenome-specific targeting:

    • Selectively target either TM2D3.L or TM2D3.S to study homeolog-specific functions

    • Create balanced versus imbalanced homeolog expression models

  • Domain-specific mutations:

    • Introduce specific mutations in functional domains (e.g., DRF motif)

    • Generate disease-relevant mutations (e.g., equivalent to human P155L)

  • Tagged endogenous protein:

    • Insert epitope or fluorescent protein tags at the endogenous locus

    • Enable tracking of native expression and localization

  • Regulatory element analysis:

    • Target enhancers and regulatory elements controlling TM2D3 expression

    • Investigate transcriptional regulation mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.