Recombinant Xenopus laevis Translocase of inner mitochondrial membrane domain-containing protein 1 (timmdc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
timmdc1; Complex I assembly factor TIMMDC1, mitochondrial; Translocase of inner mitochondrial membrane domain-containing protein 1; TIMM domain containing-protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
timmdc1
Target Protein Sequence
MAQSDPPKSPDPPLPTSIRNPQTPESGWDRIRELFQPNEQGHYPEEVGSIVKSAVTGALL GGIYGGLPAARHSKERYIQQSQAQIYQHRVEAVRSAHNAALRGFIRYGWRWGWRVAAFVT IFNSVSTGLTVYRDKLALSHYAAAGAVTGGLFRLNLGLVGLLSGSLIGAALGVPAGALIS GLQSISGESIREKKRRERQELYENKVQEWSARLQVTDEVLEEMETSQQDPLEQQVEKIQE LLQLPRNPAVSPKEGR
Uniprot No.

Target Background

Function

Function: A chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (Complex I). It plays a crucial role in constructing the membrane arm of Complex I.

Database Links

KEGG: xla:494845

UniGene: Xl.2045

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the subcellular localization of TIMMDC1 in Xenopus laevis cells?

TIMMDC1 is a predicted 4-pass membrane protein that localizes specifically to the inner mitochondrial membrane in Xenopus cells. Bioinformatic analysis using programs such as MITOPROT indicates a high probability (0.9271) of mitochondrial targeting for TIMMDC1 . Confirming this localization experimentally requires:

  • Expression of fluorescently-tagged TIMMDC1 (e.g., with EGFP or mCherry) in Xenopus cells

  • Co-staining with established mitochondrial markers (MitoTracker)

  • Confocal microscopy or super-resolution imaging

  • Subcellular fractionation followed by Western blotting of the mitochondrial fraction

In Xenopus, this localization can be visualized in live tadpoles using the imaging protocols outlined for mitochondrial visualization in the central nervous system, which involve positioning anesthetized tadpoles with fluorescently labeled cells under a coverslip for confocal microscopy .

How does TIMMDC1 expression vary during Xenopus development?

  • RT-qPCR analysis of TIMMDC1 mRNA across developmental stages

  • Whole-mount in situ hybridization to visualize spatial expression patterns

  • Immunohistochemistry using TIMMDC1-specific antibodies

  • Western blot analysis of protein extracts from different developmental stages

Since Xenopus undergoes significant immune system remodeling during metamorphosis, with thymic histolysis and impaired T cell function , examining TIMMDC1 expression during this transition may reveal important regulatory mechanisms related to mitochondrial function during tissue remodeling.

What techniques are effective for visualizing TIMMDC1 in Xenopus tissues?

Based on established protocols for imaging mitochondria in Xenopus, researchers can effectively visualize TIMMDC1 using:

  • Spinning disk confocal microscopy with the following parameters:

    • 100% laser power

    • 100ms exposure

    • 1μm z-step interval

  • Expression of fluorescently-tagged TIMMDC1 constructs (mitoEGFP-TIMMDC1)

  • Immunofluorescent labeling in fixed tissues

  • Timelapse imaging of labeled cells within 150μm of the brain surface in anesthetized tadpoles

The advantage of Xenopus for these studies is the transparency of tadpoles, making them ideal for intravital imaging of mitochondrial proteins .

How does TIMMDC1 contribute to mitochondrial complex I assembly in Xenopus compared to mammalian systems?

TIMMDC1 functions as a membrane-embedded mitochondrial complex I assembly (MCIA) factor through association with the MCIA complex . In mammalian systems, TIMMDC1 knockdown significantly and exclusively reduces the activity of mitochondrial complex I but not complexes II-IV . To study this in Xenopus:

  • Generate TIMMDC1 knockdown Xenopus cells using morpholinos or CRISPR/Cas9

  • Measure complex I activity using spectrophotometric assays monitoring NADH oxidation

  • Assess complex I assembly using blue native PAGE followed by in-gel activity assays

  • Compare oxygen consumption rates between control and TIMMDC1-depleted cells

  • Evaluate ATP production linked to complex I activity

Research has shown that in human cancer cells, TIMMDC1 knockdown causes:

  • Significant reduction in complex I activity (>50%)

  • Decreased mitochondrial respiration

  • Reduced ATP-linked oxygen consumption

These parameters should be assessed in Xenopus cells to determine conservation of function across species.

What is the relationship between TIMMDC1 and cell migration in Xenopus developmental contexts?

Studies in human cancer cells demonstrate that TIMMDC1 depletion significantly suppresses cell migration . To investigate this relationship in Xenopus:

  • Deplete TIMMDC1 in specific cell populations (neural crest, mesoderm) using targeted morpholinos

  • Perform time-lapse imaging of cell movements during development

  • Analyze migration patterns and velocities using tracking software

  • Examine focal adhesion dynamics through immunostaining for focal adhesion proteins

Microarray analysis following TIMMDC1 depletion in cancer cells revealed alterations in genes involved in:

  • Focal adhesion

  • ECM-receptor interaction

  • Cell migration inhibition (TIMP3, COL3A1)

  • Migration promotion (NUPR1)

Similar transcriptomic analysis in Xenopus cells following TIMMDC1 knockdown could reveal conserved migration-related pathways.

How does TIMMDC1 function relate to metabolic reprogramming during Xenopus development and regeneration?

Xenopus tadpoles offer an advantageous system for regeneration research, with the capacity to regenerate amputated limbs or tails . To investigate TIMMDC1's role:

  • Analyze TIMMDC1 expression during regeneration using in situ hybridization and qPCR

  • Perform TIMMDC1 knockdown specifically in regenerating tissues

  • Measure key metabolic parameters:

    • Oxygen consumption rate (OCR)

    • Extracellular acidification rate (ECAR)

    • ATP production

    • Lactate production

Data from cancer cells indicate that TIMMDC1 knockdown affects both oxidative phosphorylation and glycolysis pathways, leading to significantly lower ATP content . These metabolic effects may be particularly relevant during the energy-intensive processes of tissue regeneration in Xenopus.

What are effective protocols for TIMMDC1 knockdown in Xenopus laevis?

Researchers can effectively deplete TIMMDC1 in Xenopus using several approaches:

Morpholino oligonucleotides (MOs):

  • Design MOs targeting the translation start site or splice junctions of Xenopus TIMMDC1

  • Inject 2-10 ng of MO into 1-2 cell stage embryos

  • Include control MO injections

  • Validate knockdown efficiency by Western blot or qPCR

CRISPR/Cas9 genome editing:

  • Design sgRNAs targeting conserved regions of TIMMDC1

  • Inject Cas9 protein (500 pg) and sgRNA (300 pg) into fertilized eggs

  • Verify editing efficiency using T7 endonuclease assay or sequencing

  • Establish F0 mosaic embryos for immediate analysis or breed to generate stable lines

siRNA/shRNA:
For cultured Xenopus cells or later-stage embryos:

  • Transfect cells with TIMMDC1-targeting siRNA (50-100 nM final concentration)

  • For shRNA, clone sequences into appropriate vectors for stable expression

  • Validate knockdown after 48-72 hours using Western blot analysis

How can mitochondrial function be assessed following TIMMDC1 manipulation in Xenopus?

Following TIMMDC1 knockdown, researchers should assess these key parameters:

Mitochondrial complex activities:

  • Isolate mitochondria from control and TIMMDC1-depleted tissues

  • Measure NADH:ubiquinone oxidoreductase (Complex I) activity spectrophotometrically

  • Assess other respiratory complexes (II-IV) to confirm specificity of effects

Mitochondrial respiration:

  • Measure oxygen consumption rate using Seahorse XF analyzer or Clark-type electrodes

  • Determine basal respiration, ATP-linked respiration, maximal respiration, and reserve capacity

  • Calculate respiratory control ratio as an indicator of mitochondrial coupling efficiency

Mitochondrial membrane potential:

  • Load cells with JC-1 or TMRM fluorescent dyes

  • Analyze by flow cytometry or confocal microscopy

  • Quantify fluorescence intensity ratios (for JC-1) or absolute intensity (for TMRM)

ATP production:

  • Use luciferase-based ATP assays to quantify cellular ATP content

  • Compare ATP levels between control and TIMMDC1-depleted samples

What imaging approaches are most suitable for studying TIMMDC1 function in live Xenopus embryos?

The transparency of Xenopus tadpoles makes them ideal for live imaging studies of mitochondrial proteins. Recommended approaches include:

Confocal microscopy protocol:

  • Express fluorescently-tagged TIMMDC1 constructs in specific cell types

  • Anesthetize tadpoles in 0.02% MS-222 (tricaine)

  • Position tadpoles in a Sylgard chamber under a coverslip

  • Image using spinning disk or laser scanning confocal microscopy

  • Acquire full z-stacks with parameters:

    • 100% laser power

    • 100ms exposure time

    • 1μm z-step intervals

Timelapse parameters:

  • For mitochondrial dynamics, acquire images every 5-10 seconds

  • Limit acquisition to 5-10 minutes to prevent phototoxicity

  • Maintain temperature at 18-22°C during imaging

  • Return tadpoles to normal medium after imaging for longitudinal studies

How should researchers analyze TIMMDC1-dependent gene expression changes in Xenopus?

To analyze transcriptomic changes following TIMMDC1 manipulation:

  • Extract total RNA from control and TIMMDC1-depleted samples using TRIzol reagent

  • Perform RNA-seq or microarray analysis

  • Process data using robust multichip average (RMA) method for microarrays

  • Normalize gene expression to the mean expression of control samples

  • Apply fold-change cutoff (typically 2-fold) to identify significantly altered genes

  • Use pathway analysis tools such as:

    • Ingenuity Pathway Analysis (IPA)

    • PANTHER database for biological processes

    • Gene Ontology (GO) analysis

In human cancer cells, TIMMDC1 depletion significantly altered genes involved in:

  • Cell death regulation

  • Migration

  • Cell-cycle arrest

  • Focal adhesion

  • ECM-receptor interaction

  • p53-signaling pathways

What are common challenges in studying TIMMDC1 in Xenopus and how can they be addressed?

Researchers may encounter several challenges when studying TIMMDC1 in Xenopus:

Challenge: Embryonic lethality after complete TIMMDC1 knockdown
Solution:

  • Use inducible or tissue-specific knockdown approaches

  • Employ partial knockdown using titrated MO concentrations

  • Use pharmacological inhibitors of complex I as alternative approach

Challenge: Distinguishing direct vs. indirect effects of TIMMDC1 depletion
Solution:

  • Perform rescue experiments with wild-type TIMMDC1

  • Use point mutants to identify critical functional domains

  • Conduct time-course experiments to establish temporal relationships

  • Compare with effects of specific complex I inhibitors

Challenge: Antibody specificity issues for Xenopus TIMMDC1
Solution:

  • Generate Xenopus-specific antibodies

  • Use epitope-tagged TIMMDC1 constructs

  • Validate antibody specificity using TIMMDC1 knockout samples as negative controls

How can researchers reconcile conflicting data on TIMMDC1 function between Xenopus and mammalian models?

When conflicting results arise between species:

  • Compare protein sequence conservation between Xenopus and mammalian TIMMDC1

  • Perform cross-species rescue experiments (express human TIMMDC1 in Xenopus)

  • Conduct detailed structure-function analyses to identify species-specific domains

  • Consider developmental context and timing of experiments

  • Examine post-translational modifications that might differ between species

  • Assess protein-protein interactions in both systems using co-immunoprecipitation or proximity labeling approaches

How is TIMMDC1 research in Xenopus contributing to cancer biology studies?

Xenopus provides valuable insights for cancer research related to TIMMDC1:

  • The transparency of tadpoles enables visualization of mitochondrial dynamics in potential metastatic cells

  • Cancer studies have shown that TIMMDC1 depletion inhibits both cell migration and proliferation

  • Xenopus tadpoles can be used to study the role of TIMMDC1 in the following cancer-related processes:

    • Cell migration during development (model for metastasis)

    • Proliferation in rapidly dividing embryonic tissues

    • Metabolic reprogramming (Warburg effect)

    • Cell survival under stress conditions

Data from human cancer studies indicate that TIMMDC1 knockdown significantly suppresses growth and migration of:

  • Lung carcinoma cells (95D)

  • Gastric cancer cells (SGC-7901 and BGC-823)

These findings suggest TIMMDC1 as a potential therapeutic target, which can be further explored using Xenopus as a preliminary model.

How can Xenopus models advance our understanding of TIMMDC1's role in mitochondrial disease?

Xenopus laevis offers several advantages for studying TIMMDC1-related mitochondrial disorders:

  • External development allows easy access to all developmental stages

  • Transparency of tadpoles enables real-time visualization of mitochondria in tissues

  • Genetic manipulation is straightforward via microinjection

  • Large clutch sizes provide statistical power for experiments

Research approaches include:

  • Creating TIMMDC1-deficient Xenopus as models of mitochondrial dysfunction

  • Testing potential therapeutic compounds in TIMMDC1-deficient tadpoles

  • Performing high-throughput drug screening using tadpoles with mitochondrial defects

  • Studying tissue-specific effects of TIMMDC1 dysfunction, particularly in high-energy tissues like muscle and nerve

A key advantage of Xenopus for these studies is the ability to perform in vivo imaging of mitochondrial dynamics in the developing central nervous system , which is particularly relevant for neurodegenerative aspects of mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.