Recombinant Xenopus laevis Transmembrane protein 11-A, mitochondrial (TMEM11-A) is a protein expressed in E. coli and tagged with N-terminal His for research purposes . TMEM11 is a mitochondrial protein involved in mitophagy, the process by which mitochondria are selectively targeted for degradation . Studies show that TMEM11 interacts with BNIP3 and BNIP3L, which are proteins that recruit autophagy proteins to mitochondria .
| Feature | Description |
|---|---|
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-187 amino acids) |
| Form | Lyophilized powder |
| Amino Acid Sequence | MATWGRRRAGLGGRERVTLSAGECYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWVTVGNCLHKTAVLSGTACLLTPLALPAEYSHYVSLPAGVLSLACSTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSSPVVLVRKDDIHRKRLHNTIALAALAYCIKKLYELYSV |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage |
| Gene Name | tmem11-a |
| Synonyms | tmem11-a; tmem11; Transmembrane protein 11-A, mitochondrial |
| UniProt ID | A2BD92 |
TMEM11 is essential for maintaining normal mitochondrial morphology . TMEM11 forms a complex with BNIP3 and BNIP3L and is co-enriched at the sites of mitophagosome formation . Mitophagy is hyper-activated in the absence of TMEM11 during normoxia and hypoxia-mimetic conditions because of an increase in BNIP3/BNIP3L mitophagy sites .
Research indicates that TMEM11 is localized inside mitochondria . TMEM11 regulates mitochondrial shape in human cells . Reduction of TMEM11 levels in human cells results in a condensation of the mitochondrial network with a loss of tubular shape .
Studies show that TMEM11 inhibits cardiomyocyte proliferation and cardiac regeneration in vitro . TMEM11 deletion enhanced cardiomyocyte proliferation and restored heart function after myocardial injury . TMEM11 directly interacts with METTL1 and enhanced $$m^7G$$ modification, which is a key regulator of gene expression .
TMEM11 depletion increases BNIP3/BNIP3L-dependent mitophagy at steady-state, and TMEM11 co-enriches with BNIP3 and BNIP3L at discrete structures on the outer mitochondrial membrane (OMM) during induced BNIP3/BNIP3L-dependent mitophagy . TMEM11-enriched sites are indeed mitophagosomes, as evidenced by the recruitment of autophagy machinery to these sites .
KEGG: xla:100037074
UniGene: Xl.55443
TMEM11-A functions primarily as a regulator of mitochondrial dynamics and cellular metabolism. In uninjured Xenopus laevis, mitochondrial markers including TMEM11-A are predominantly expressed in neural stem progenitor cells (NSPCs) surrounding the spinal cord central canal. This localization is consistent with observations in other animal models such as zebrafish and macaques. The protein plays a role in maintaining mitochondrial distribution, particularly in areas with high energy demands such as the apical region of cells where ciliary roots are located and ATP-dependent ciliary beating occurs .
Additionally, TMEM11 has been identified as a regulator of cell cycle activity, interacting with methyltransferase-like protein 1 (METTL1) to influence RNA m7G-methylation activity. This interaction affects downstream targets like activating transcription factor 5 (ATF5), which regulates inhibitors of cyclin-dependent kinases .
Researchers typically employ multiple approaches to study recombinant TMEM11-A:
Protein Expression Systems: Recombinant TMEM11-A is commonly expressed in E. coli systems with His-tags for purification purposes .
Microscopy Techniques:
Functional Assays:
Genetic Models:
Molecular Interaction Studies:
TMEM11-A influences both mitochondrial morphology and spatial distribution within cells. Research in Xenopus laevis spinal cord regeneration models has revealed that:
Morphological Changes: After spinal cord injury (SCI), mitochondria exhibit phenotypic changes, shifting toward a swollen morphology. This morphological adaptation is associated with TMEM11-A function but interestingly does not compromise mitochondrial respiratory capacity as demonstrated by maintained COX/SDH staining .
Distribution Patterns: In uninjured tissues, mitochondria show apical localization in NSPCs surrounding the central canal, an area with high energy demands. Following SCI, this organized distribution pattern is disrupted, potentially reflecting altered energy requirements during the regenerative response .
Quantitative Changes: SCI triggers a decrease in the number of mitochondria per cell section, accompanied by an increase in individual mitochondrial area and circularity. These quantitative changes suggest mitochondrial fusion events possibly regulated by TMEM11-A .
The altered mitochondrial phenotype appears to be adaptive rather than degenerative, as it occurs alongside maintained cellular energy balance and supports the metabolic needs of regenerating tissues.
TMEM11-A plays a crucial role in the metabolic reprogramming that occurs during regenerative processes, particularly following spinal cord injury in Xenopus laevis. The relationship between this protein and cellular metabolism is characterized by:
Metabolic Shift: Following SCI, NSPCs exhibit a transient shift toward glycolytic metabolism, which coincides with changes in TMEM11-A function and mitochondrial dynamics. This shift is evidenced by:
Temporal Regulation: The metabolic adaptation is precisely timed, with:
Functional Significance: This metabolic reprogramming is thought to be necessary for:
| Time Point | Mitochondrial Membrane Potential | Metabolic Profile | NSPC Proliferation |
|---|---|---|---|
| Uninjured | Normal | Balanced oxidative/glycolytic | Baseline |
| 6 hpt | Decreased | Shift toward glycolysis | Increasing |
| 24 hpt | Returned to baseline | Glycolytic predominance | Peak activity |
| >24 hpt | Normal | Gradual return to balanced metabolism | Decreasing toward differentiation |
This temporal regulation of metabolism via TMEM11-A appears to be a critical adaptation that facilitates the regenerative capacity of Xenopus laevis spinal cord.
TMEM11-A has been identified as a direct interaction partner with methyltransferase-like protein 1 (METTL1), forming a crucial regulatory complex that influences RNA m7G-methylation activities. This interaction has significant implications for gene expression regulation:
Direct Protein-Protein Interaction: Research indicates that TMEM11 physically binds to METTL1, enhancing its RNA m7G-methylation activity. This direct interaction provides a novel link between mitochondrial transmembrane proteins and epigenetic regulation of gene expression .
Target Specificity: The TMEM11-METTL1 complex demonstrates selectivity in its methylation targets, with activating transcription factor 5 (ATF5) mRNA being a primary substrate. The interaction results in hypermethylation of Atf5 mRNA, leading to increased ATF5 protein expression .
Signaling Cascade: The pathway proceeds through the following sequence:
TMEM11 binds and activates METTL1
Enhanced METTL1 activity increases m7G methylation of target mRNAs
Hypermethylated Atf5 mRNA leads to upregulated ATF5 protein expression
Elevated ATF5 enhances expression of INCA1 (inhibitor of cyclin-dependent kinase interacting with cyclin A1)
This signaling pathway positions TMEM11-A as an upstream regulator of cell proliferation through epigenetic mechanisms, significantly expanding our understanding of how mitochondrial proteins can influence nuclear gene expression programs.
Investigating TMEM11-A interactions requires specialized techniques that can capture both protein-protein and protein-RNA interactions:
Co-immunoprecipitation (Co-IP):
Methodology: Antibodies against TMEM11-A or suspected interaction partners are used to pull down protein complexes from cell lysates
Applications: Effective for detecting stable protein-protein interactions, such as the TMEM11-METTL1 complex
Validation: Western blotting with specific antibodies confirms the presence of interaction partners
RNA Immunoprecipitation (RIP):
Protocol Outline:
a. Extract total RNA from cardiomyocytes or tissues
b. Fragment RNA using RNase MiniElute Kit
c. Pre-clear with protein A/G magnetic beads
d. Incubate with antibodies against TMEM11-A or partner proteins
e. Purify RNA and perform reverse transcription followed by qPCR
Applications: Identifies RNA molecules that interact with TMEM11-A or its complex partners
Proximity Ligation Assay (PLA):
Methodology: Uses antibody pairs and oligonucleotide-conjugated secondary antibodies to detect proteins in close proximity (<40 nm)
Applications: Provides spatial information about TMEM11-A interactions within cellular compartments
FRET/FLIM Analysis:
Methodology: Measures energy transfer between fluorophore-tagged proteins when in close proximity
Applications: Detects transient interactions and provides real-time interaction dynamics in living cells
Crosslinking Mass Spectrometry (XL-MS):
Methodology: Proteins are crosslinked in vivo, digested, and analyzed by mass spectrometry
Applications: Identifies novel interaction partners and provides structural information about interaction interfaces
These methodologies can be combined in a workflow to comprehensively characterize TMEM11-A interactions, starting with discovery-based approaches like XL-MS and confirming specific interactions with targeted methods like Co-IP and RIP.
TMEM11-A represents a promising target for cardiac regeneration research based on its role in regulating cardiomyocyte proliferation:
Mechanism of Action in Cardiac Tissue:
TMEM11 suppresses cardiomyocyte cell cycle activity through a well-defined molecular pathway:
Experimental Models:
Several genetic models have been developed to study TMEM11 function in cardiac regeneration:
Potential Therapeutic Approaches:
TMEM11 Inhibition: Targeting the TMEM11-METTL1-ATF5 axis could enhance cardiomyocyte proliferation after cardiac injury
Temporal Modulation: Controlled suppression of TMEM11 during specific regenerative windows may promote heart repair
Combination Therapies: Coupling TMEM11 inhibition with other regenerative factors could synergistically enhance cardiac regeneration
Experimental Readouts for Regenerative Capacity:
Cardiomyocyte proliferation markers (Ki67, EdU incorporation)
Cell cycle activity assays
Functional recovery measurements (echocardiography)
Fibrosis assessment
Cardiac output parameters
This research direction suggests that targeted modulation of TMEM11-A could represent an effective strategy for improving heart regeneration after cardiac injury.
Purifying functional recombinant TMEM11-A presents several technical challenges due to its nature as a mitochondrial transmembrane protein:
Membrane Protein Solubility Issues:
Challenge: TMEM11-A contains multiple transmembrane domains, making it highly hydrophobic and prone to aggregation during expression and purification
Solution Approaches:
Optimization of detergent types and concentrations
Use of solubilizing tags (e.g., SUMO, MBP) in addition to His-tag
Sequential extraction protocols with increasing detergent strengths
Proper Folding and Conformation:
Challenge: Maintaining native conformation during expression in heterologous systems like E. coli
Solution Approaches:
Expression at lower temperatures (16-18°C)
Inclusion of molecular chaperones as co-expression partners
Use of eukaryotic expression systems for more complex post-translational modifications
Mitochondrial Targeting and Processing:
Challenge: Recombinant TMEM11-A may require specific processing of mitochondrial targeting sequences
Solution Approaches:
Design of constructs with and without predicted targeting sequences
Co-expression with mitochondrial processing peptidases
Verification of proper N-terminal processing by mass spectrometry
Preservation of Functional Activity:
Challenge: Maintaining protein activity during purification and storage
Solution Approaches:
Quality Control Parameters:
Successfully addressing these challenges requires a systematic optimization approach, often specific to the intended downstream application of the purified protein.
Comparative analysis of TMEM11-A function between Xenopus laevis and mammalian models reveals both conserved and divergent aspects:
Conserved Molecular Interactions:
Both amphibian and mammalian TMEM11 proteins interact with the methyltransferase METTL1, suggesting this regulatory mechanism is evolutionarily conserved. This conservation extends to the downstream effectors in the signaling pathway, where ATF5 represents a common target in both systems .
Tissue-Specific Functions:
| Aspect | Xenopus laevis | Mammalian Models |
|---|---|---|
| Neural Regeneration | TMEM11-A regulates mitochondrial dynamics during spinal cord regeneration | Limited regenerative capacity in spinal cord; TMEM11 studied primarily in other contexts |
| Cardiac Function | Less extensively studied | TMEM11 suppresses cardiomyocyte proliferation and influences cardiac repair |
| Metabolic Adaptation | Transient glycolytic shift in neural tissues after injury | Similar metabolic shifts observed in various tissues during stress response |
Regenerative Capacity Differences:
The most striking difference between these models is their inherent regenerative capacity. Xenopus laevis possesses remarkable spinal cord regenerative abilities, with TMEM11-A participating in the transient metabolic shift toward glycolysis that facilitates this process . In contrast, mammals have limited regenerative capacity, particularly in neural tissues, though TMEM11 has been implicated in cardiac regeneration pathways .
Experimental Advantages of Each Model:
Xenopus laevis Advantages:
Mammalian Model Advantages:
Closer physiological relevance to human conditions
More extensive genetic tools available
Better characterized signaling pathways
Established disease models
Translational Implications:
Understanding how TMEM11-A functions in the highly regenerative context of Xenopus laevis provides valuable insights that can potentially be applied to enhance limited regenerative processes in mammals. The conserved TMEM11-METTL1-ATF5 axis identified across species represents a promising therapeutic target for promoting regeneration in human tissues .
This comparative approach highlights the value of studying TMEM11-A across different model organisms to gain comprehensive insights into its fundamental biological functions and potential therapeutic applications.
Understanding the regulatory mechanisms controlling TMEM11-A expression would require multi-layered experimental approaches:
Transcriptional Regulation Studies:
Promoter Analysis:
Bioinformatic identification of putative transcription factor binding sites
Reporter assays with serial promoter deletions to map regulatory regions
ChIP-seq to identify transcription factors binding to the TMEM11-A promoter
Epigenetic Regulation:
DNA methylation analysis of the promoter region using bisulfite sequencing
Histone modification mapping using ChIP-seq for marks like H3K4me3, H3K27ac
Chromatin accessibility assessment using ATAC-seq
Response Element Characterization:
Stimulation experiments with various cellular stressors (hypoxia, metabolic stress)
Site-directed mutagenesis of key regulatory elements
Single-cell approaches to capture heterogeneity in expression regulation
Post-Transcriptional Regulation:
miRNA Targeting:
Bioinformatic prediction of miRNA binding sites in TMEM11-A mRNA
miRNA overexpression and inhibition studies
CLIP-seq to map direct RNA-protein interactions
RNA Stability Analyses:
Actinomycin D chase experiments to measure mRNA half-life
Identification of RNA-binding proteins that affect stability
Assessment of m7G methylation on TMEM11-A's own transcript
Translational and Post-Translational Regulation:
Protein Synthesis Control:
Polysome profiling to assess translational efficiency
Ribosome profiling to map translation initiation sites
Protein Modifications:
Mass spectrometry to identify phosphorylation, ubiquitination, or other modifications
Site-directed mutagenesis of modification sites
Inhibitor studies targeting specific modifying enzymes
Developmental and Tissue-Specific Regulation:
Temporal Expression Profiling:
RNA-seq and protein analysis across developmental stages
Single-cell RNA-seq to capture cell-type specific regulation
Conditional Expression Systems:
Tissue-specific promoters controlling TMEM11-A expression
Inducible systems to temporally control expression
Integration with Cellular Signaling Pathways:
Pathway Perturbation:
Pharmacological inhibition or activation of major signaling pathways
CRISPR screening to identify regulatory factors
Phosphoproteomics following pathway stimulation
These approaches would provide complementary insights into the complex regulatory network controlling TMEM11-A expression across different cellular contexts and physiological states.
TMEM11-A's involvement in mitochondrial dynamics and metabolic reprogramming positions it as a potential target for various regenerative medicine applications:
Neural Regeneration Applications:
Spinal Cord Injury Therapy:
Building on findings in Xenopus laevis, targeted modulation of TMEM11-A could promote the transient glycolytic shift observed during successful spinal cord regeneration . This approach might involve:
Temporally controlled inhibition of TMEM11-A function
Delivery of modified TMEM11-A proteins to injury sites
Gene therapy approaches to modulate TMEM11-A expression in damaged neural tissues
Neurodegenerative Disease Treatment:
Since mitochondrial dysfunction is implicated in conditions like Alzheimer's and Parkinson's diseases, TMEM11-A modulation could potentially:
Restore proper mitochondrial morphology and distribution
Enhance bioenergetic function in compromised neurons
Promote neural stem cell activation and differentiation
Metabolic Tissue Regeneration:
Liver Regeneration Enhancement:
The liver's regenerative capacity relies heavily on metabolic reprogramming similar to that observed with TMEM11-A function:
Promoting transient glycolysis in hepatocytes after injury
Enhancing proliferative capacity during regenerative phases
Supporting mitochondrial remodeling during tissue regrowth
Pancreatic β-cell Regeneration:
Diabetes therapies could potentially benefit from TMEM11-A modulation to:
Enhance β-cell proliferation through the TMEM11-METTL1-ATF5 pathway
Optimize mitochondrial function for insulin secretion
Support metabolic adaptations during regenerative processes
Skeletal Muscle Regeneration:
Injury Recovery Acceleration:
Modulating TMEM11-A could enhance myoblast proliferation and differentiation through:
Temporal control of cell cycle regulation via the ATF5-INCA1 axis
Metabolic support during different phases of muscle regeneration
Optimization of mitochondrial networks during myofiber formation
Age-Related Sarcopenia Treatment:
TMEM11-A targeting could potentially address:
Declined satellite cell activation in aging muscle
Impaired mitochondrial quality control
Compromised metabolic flexibility
Engineering Approaches:
Biomaterial Integration:
TMEM11-A modulators could be incorporated into:
Controlled-release scaffolds for tissue engineering
Injectable hydrogels for targeted delivery to injury sites
Nanoparticle formulations for cell-specific targeting
Ex Vivo Tissue Engineering:
Manipulation of TMEM11-A in cultured cells prior to transplantation could:
Enhance survival and integration of transplanted tissues
Prime cells for optimal regenerative performance
Create metabolically optimized tissue constructs
The development of these applications would require systematic validation in mammalian models before clinical translation, but the evolutionary conservation of TMEM11-A function suggests promising potential across vertebrate species.
Despite significant advances in understanding TMEM11-A biology, several critical questions remain unresolved:
Structural Biology Questions:
What is the three-dimensional structure of TMEM11-A and how does it influence its interaction with mitochondrial membranes?
Which specific domains mediate its interaction with METTL1 and other binding partners?
How do conformational changes in TMEM11-A regulate its various functions?
Regulatory Network Integration:
How is TMEM11-A expression and activity regulated across different tissues and developmental stages?
What are the upstream signals that modulate TMEM11-A function during regenerative processes?
How does TMEM11-A integrate into broader cellular stress response networks?
Metabolic Control Mechanisms:
What are the precise mechanisms by which TMEM11-A influences the switch between oxidative phosphorylation and glycolysis?
How does TMEM11-A communicate between mitochondria and the nucleus to coordinate metabolic adaptation?
Are there tissue-specific metabolic roles for TMEM11-A beyond what has been observed in neural and cardiac tissues?
Evolutionary Perspective Questions:
Pathophysiological Relevance:
Is TMEM11-A dysfunction implicated in human diseases, particularly those involving mitochondrial dysfunction?
Could TMEM11-A genetic variants contribute to differential regenerative capacity among individuals?
How might TMEM11-A be targeted therapeutically without disrupting essential physiological functions?
Technical Challenges:
What are the optimal methods for studying TMEM11-A in its native mitochondrial environment?
How can we develop tools to monitor TMEM11-A activity in real-time in living cells?
What are the best approaches for selective pharmacological modulation of TMEM11-A function?
Addressing these questions will require interdisciplinary approaches combining structural biology, advanced imaging, genetic manipulation, and systems biology perspectives. The answers will not only enhance our fundamental understanding of TMEM11-A biology but also inform potential therapeutic applications in regenerative medicine.
Reconciling seemingly contradictory findings about TMEM11-A requires careful consideration of experimental context and methodological approaches:
Contextual Factors Influencing Experimental Outcomes:
Species Differences:
Findings from Xenopus laevis may differ from mammalian models due to evolutionary adaptations. While the core functions may be conserved, the regulatory networks and physiological roles could vary significantly between amphibians and mammals .
Tissue-Specific Contexts:
TMEM11-A appears to have distinct functions in neural versus cardiac contexts. In neural tissues, it regulates metabolic shifts during regeneration , while in cardiac tissue, it influences cardiomyocyte proliferation through the METTL1-ATF5-INCA1 axis .
Developmental Stage Considerations:
The function of TMEM11-A may vary across developmental stages, potentially explaining discrepancies between studies using embryonic versus adult tissues.
Methodological Reconciliation Approaches:
Standardization of Experimental Conditions:
| Parameter | Recommendation for Standardization |
|---|---|
| Cell Types | Clear definition of cell populations (e.g., NSPCs GFP+ vs. non-NSPCs GFP-) |
| Timepoints | Precise temporal characterization (e.g., 6 hpt vs. 24 hpt) |
| Injury Models | Standardized lesion protocols with clear anatomical boundaries |
| Readout Methods | Consensus metrics for mitochondrial function and morphology |
Multi-level Analysis Framework:
Integrating analyses at different biological levels can resolve apparent contradictions:
Molecular interactions (protein-protein, protein-RNA)
Subcellular localization and dynamics
Cellular physiology and metabolism
Tissue-level responses
Whole-organism phenotypes
Technical Considerations for Data Interpretation:
Knockout vs. Knockdown Differences:
Complete knockout models may trigger compensatory mechanisms absent in temporary knockdown approaches, potentially explaining divergent phenotypes .
Overexpression Artifacts:
Protein overexpression can lead to non-physiological interactions or dominant-negative effects that complicate interpretation of TMEM11-A function .
Fusion Tag Interference:
His-tags or fluorescent protein fusions may alter TMEM11-A's localization, stability, or interaction profile .
Integrated Data Interpretation Model:
A comprehensive model of TMEM11-A function should account for:
Temporal Dynamics: Different functions may predominate at different timepoints after injury
Spatial Regulation: Subcellular localization may determine function
Interaction Partners: Tissue-specific binding partners may dictate diverse functions
Metabolic Context: The prevailing metabolic state may influence TMEM11-A activity
By systematically addressing these factors, researchers can develop a unified model of TMEM11-A function that accommodates apparently contradictory observations and provides a framework for predicting context-dependent activities of this multifunctional protein.