Recombinant Xenopus laevis Transmembrane protein 11-A, mitochondrial (tmem11-a)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus laevis Transmembrane Protein 11-A, Mitochondrial (TMEM11-A)

Recombinant Xenopus laevis Transmembrane protein 11-A, mitochondrial (TMEM11-A) is a protein expressed in E. coli and tagged with N-terminal His for research purposes . TMEM11 is a mitochondrial protein involved in mitophagy, the process by which mitochondria are selectively targeted for degradation . Studies show that TMEM11 interacts with BNIP3 and BNIP3L, which are proteins that recruit autophagy proteins to mitochondria .

Table 1: Key Features of Recombinant Xenopus laevis TMEM11-A Protein

FeatureDescription
SourceE. coli
TagHis
Protein LengthFull Length (1-187 amino acids)
FormLyophilized powder
Amino Acid SequenceMATWGRRRAGLGGRERVTLSAGECYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWVTVGNCLHKTAVLSGTACLLTPLALPAEYSHYVSLPAGVLSLACSTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSSPVVLVRKDDIHRKRLHNTIALAALAYCIKKLYELYSV
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add 5-50% glycerol for long-term storage
Gene Nametmem11-a
Synonymstmem11-a; tmem11; Transmembrane protein 11-A, mitochondrial
UniProt IDA2BD92

Function and Significance

TMEM11 is essential for maintaining normal mitochondrial morphology . TMEM11 forms a complex with BNIP3 and BNIP3L and is co-enriched at the sites of mitophagosome formation . Mitophagy is hyper-activated in the absence of TMEM11 during normoxia and hypoxia-mimetic conditions because of an increase in BNIP3/BNIP3L mitophagy sites .

TMEM11 and Mitochondrial Dynamics

Research indicates that TMEM11 is localized inside mitochondria . TMEM11 regulates mitochondrial shape in human cells . Reduction of TMEM11 levels in human cells results in a condensation of the mitochondrial network with a loss of tubular shape .

Role in Cardiomyocyte Proliferation and Cardiac Repair

Studies show that TMEM11 inhibits cardiomyocyte proliferation and cardiac regeneration in vitro . TMEM11 deletion enhanced cardiomyocyte proliferation and restored heart function after myocardial injury . TMEM11 directly interacts with METTL1 and enhanced $$m^7G$$ modification, which is a key regulator of gene expression .

TMEM11 and Mitophagy

TMEM11 depletion increases BNIP3/BNIP3L-dependent mitophagy at steady-state, and TMEM11 co-enriches with BNIP3 and BNIP3L at discrete structures on the outer mitochondrial membrane (OMM) during induced BNIP3/BNIP3L-dependent mitophagy . TMEM11-enriched sites are indeed mitophagosomes, as evidenced by the recruitment of autophagy machinery to these sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem11-a; tmem11; Transmembrane protein 11-A, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem11-a
Target Protein Sequence
MATWGRRRAGLGGRERVTLSAGECYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPT RIGDETARWVTVGNCLHKTAVLSGTACLLTPLALPAEYSHYVSLPAGVLSLACSTLYGIS WQFDPCCKYQVEYDAYKLSRLPLHTLTSSSPVVLVRKDDIHRKRLHNTIALAALAYCIKK LYELYSV
Uniprot No.

Target Background

Function
This protein plays a role in mitochondrial morphogenesis.
Database Links

KEGG: xla:100037074

UniGene: Xl.55443

Protein Families
TMEM11 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does TMEM11-A function in normal cellular processes?

TMEM11-A functions primarily as a regulator of mitochondrial dynamics and cellular metabolism. In uninjured Xenopus laevis, mitochondrial markers including TMEM11-A are predominantly expressed in neural stem progenitor cells (NSPCs) surrounding the spinal cord central canal. This localization is consistent with observations in other animal models such as zebrafish and macaques. The protein plays a role in maintaining mitochondrial distribution, particularly in areas with high energy demands such as the apical region of cells where ciliary roots are located and ATP-dependent ciliary beating occurs .

Additionally, TMEM11 has been identified as a regulator of cell cycle activity, interacting with methyltransferase-like protein 1 (METTL1) to influence RNA m7G-methylation activity. This interaction affects downstream targets like activating transcription factor 5 (ATF5), which regulates inhibitors of cyclin-dependent kinases .

What experimental approaches are used to study recombinant TMEM11-A?

Researchers typically employ multiple approaches to study recombinant TMEM11-A:

  • Protein Expression Systems: Recombinant TMEM11-A is commonly expressed in E. coli systems with His-tags for purification purposes .

  • Microscopy Techniques:

    • Electron microscopy for visualizing mitochondrial morphology

    • Confocal microscopy for tracking protein localization

    • Live cell imaging to monitor dynamic changes in mitochondrial function

  • Functional Assays:

    • Mitochondrial membrane potential measurement using dyes like tetramethylrhodamine (TMRE)

    • COX/SDH staining to assess mitochondrial respiratory function

    • Analysis of glycolytic enzyme activity

  • Genetic Models:

    • CRISPR/Cas9-generated knockout models

    • Transgenic overexpression systems using tissue-specific promoters (e.g., α-myosin heavy chain for cardiac-specific expression)

  • Molecular Interaction Studies:

    • Co-immunoprecipitation for protein-protein interactions

    • RNA immunoprecipitation for RNA-protein interactions

How does TMEM11-A affect mitochondrial morphology and distribution?

TMEM11-A influences both mitochondrial morphology and spatial distribution within cells. Research in Xenopus laevis spinal cord regeneration models has revealed that:

  • Morphological Changes: After spinal cord injury (SCI), mitochondria exhibit phenotypic changes, shifting toward a swollen morphology. This morphological adaptation is associated with TMEM11-A function but interestingly does not compromise mitochondrial respiratory capacity as demonstrated by maintained COX/SDH staining .

  • Distribution Patterns: In uninjured tissues, mitochondria show apical localization in NSPCs surrounding the central canal, an area with high energy demands. Following SCI, this organized distribution pattern is disrupted, potentially reflecting altered energy requirements during the regenerative response .

  • Quantitative Changes: SCI triggers a decrease in the number of mitochondria per cell section, accompanied by an increase in individual mitochondrial area and circularity. These quantitative changes suggest mitochondrial fusion events possibly regulated by TMEM11-A .

The altered mitochondrial phenotype appears to be adaptive rather than degenerative, as it occurs alongside maintained cellular energy balance and supports the metabolic needs of regenerating tissues.

What is the relationship between TMEM11-A and cellular metabolism during regenerative processes?

TMEM11-A plays a crucial role in the metabolic reprogramming that occurs during regenerative processes, particularly following spinal cord injury in Xenopus laevis. The relationship between this protein and cellular metabolism is characterized by:

  • Metabolic Shift: Following SCI, NSPCs exhibit a transient shift toward glycolytic metabolism, which coincides with changes in TMEM11-A function and mitochondrial dynamics. This shift is evidenced by:

    • Increased transcript levels of glycolytic genes

    • Enhanced glycolytic enzyme activity

    • Early and transient decline in mitochondrial activity

  • Temporal Regulation: The metabolic adaptation is precisely timed, with:

    • Decreased mitochondrial membrane potential observed in NSPCs at 6 hours post-transection (hpt)

    • Return to basal levels by 24 hpt

    • No corresponding changes detected in non-NSPC cells, suggesting cell-type specificity

  • Functional Significance: This metabolic reprogramming is thought to be necessary for:

    • Supporting the high proliferation rate of NSPCs after injury

    • Activating anabolic pathways for generating cellular building blocks

    • Remodeling cell cycle regulatory proteins

    • Maintaining NSPC identity during proliferative phases

Time PointMitochondrial Membrane PotentialMetabolic ProfileNSPC Proliferation
UninjuredNormalBalanced oxidative/glycolyticBaseline
6 hptDecreasedShift toward glycolysisIncreasing
24 hptReturned to baselineGlycolytic predominancePeak activity
>24 hptNormalGradual return to balanced metabolismDecreasing toward differentiation

This temporal regulation of metabolism via TMEM11-A appears to be a critical adaptation that facilitates the regenerative capacity of Xenopus laevis spinal cord.

How does TMEM11-A interact with the METTL1-mediated RNA methylation pathway?

TMEM11-A has been identified as a direct interaction partner with methyltransferase-like protein 1 (METTL1), forming a crucial regulatory complex that influences RNA m7G-methylation activities. This interaction has significant implications for gene expression regulation:

  • Direct Protein-Protein Interaction: Research indicates that TMEM11 physically binds to METTL1, enhancing its RNA m7G-methylation activity. This direct interaction provides a novel link between mitochondrial transmembrane proteins and epigenetic regulation of gene expression .

  • Target Specificity: The TMEM11-METTL1 complex demonstrates selectivity in its methylation targets, with activating transcription factor 5 (ATF5) mRNA being a primary substrate. The interaction results in hypermethylation of Atf5 mRNA, leading to increased ATF5 protein expression .

  • Signaling Cascade: The pathway proceeds through the following sequence:

    • TMEM11 binds and activates METTL1

    • Enhanced METTL1 activity increases m7G methylation of target mRNAs

    • Hypermethylated Atf5 mRNA leads to upregulated ATF5 protein expression

    • Elevated ATF5 enhances expression of INCA1 (inhibitor of cyclin-dependent kinase interacting with cyclin A1)

    • INCA1 suppresses cell cycle progression and proliferation

This signaling pathway positions TMEM11-A as an upstream regulator of cell proliferation through epigenetic mechanisms, significantly expanding our understanding of how mitochondrial proteins can influence nuclear gene expression programs.

What methodologies can detect TMEM11-A interactions with other cellular components?

Investigating TMEM11-A interactions requires specialized techniques that can capture both protein-protein and protein-RNA interactions:

  • Co-immunoprecipitation (Co-IP):

    • Methodology: Antibodies against TMEM11-A or suspected interaction partners are used to pull down protein complexes from cell lysates

    • Applications: Effective for detecting stable protein-protein interactions, such as the TMEM11-METTL1 complex

    • Validation: Western blotting with specific antibodies confirms the presence of interaction partners

  • RNA Immunoprecipitation (RIP):

    • Protocol Outline:
      a. Extract total RNA from cardiomyocytes or tissues
      b. Fragment RNA using RNase MiniElute Kit
      c. Pre-clear with protein A/G magnetic beads
      d. Incubate with antibodies against TMEM11-A or partner proteins
      e. Purify RNA and perform reverse transcription followed by qPCR

    • Applications: Identifies RNA molecules that interact with TMEM11-A or its complex partners

  • Proximity Ligation Assay (PLA):

    • Methodology: Uses antibody pairs and oligonucleotide-conjugated secondary antibodies to detect proteins in close proximity (<40 nm)

    • Applications: Provides spatial information about TMEM11-A interactions within cellular compartments

  • FRET/FLIM Analysis:

    • Methodology: Measures energy transfer between fluorophore-tagged proteins when in close proximity

    • Applications: Detects transient interactions and provides real-time interaction dynamics in living cells

  • Crosslinking Mass Spectrometry (XL-MS):

    • Methodology: Proteins are crosslinked in vivo, digested, and analyzed by mass spectrometry

    • Applications: Identifies novel interaction partners and provides structural information about interaction interfaces

These methodologies can be combined in a workflow to comprehensively characterize TMEM11-A interactions, starting with discovery-based approaches like XL-MS and confirming specific interactions with targeted methods like Co-IP and RIP.

How can TMEM11-A be utilized in cardiac regeneration research?

TMEM11-A represents a promising target for cardiac regeneration research based on its role in regulating cardiomyocyte proliferation:

  • Mechanism of Action in Cardiac Tissue:
    TMEM11 suppresses cardiomyocyte cell cycle activity through a well-defined molecular pathway:

    • TMEM11 interacts with METTL1, enhancing its RNA m7G-methylation activity

    • This interaction increases hypermethylation of Atf5 mRNA

    • Upregulated ATF5 enhances expression of INCA1

    • INCA1 inhibits cyclin-dependent kinase activity, suppressing cardiomyocyte proliferation

  • Experimental Models:
    Several genetic models have been developed to study TMEM11 function in cardiac regeneration:

    • TMEM11 Knockout Mice: Generated using CRISPR/Cas9 technology targeting exon 2 of the Tmem11 gene, which contains most of the coding sequence

    • TMEM11 Transgenic Mice: Heart-specific overexpression achieved using the α-myosin heavy chain (MHC) promoter

  • Potential Therapeutic Approaches:

    • TMEM11 Inhibition: Targeting the TMEM11-METTL1-ATF5 axis could enhance cardiomyocyte proliferation after cardiac injury

    • Temporal Modulation: Controlled suppression of TMEM11 during specific regenerative windows may promote heart repair

    • Combination Therapies: Coupling TMEM11 inhibition with other regenerative factors could synergistically enhance cardiac regeneration

  • Experimental Readouts for Regenerative Capacity:

    • Cardiomyocyte proliferation markers (Ki67, EdU incorporation)

    • Cell cycle activity assays

    • Functional recovery measurements (echocardiography)

    • Fibrosis assessment

    • Cardiac output parameters

This research direction suggests that targeted modulation of TMEM11-A could represent an effective strategy for improving heart regeneration after cardiac injury.

What are the technical challenges in purifying functional recombinant TMEM11-A protein?

Purifying functional recombinant TMEM11-A presents several technical challenges due to its nature as a mitochondrial transmembrane protein:

  • Membrane Protein Solubility Issues:

    • Challenge: TMEM11-A contains multiple transmembrane domains, making it highly hydrophobic and prone to aggregation during expression and purification

    • Solution Approaches:

      • Optimization of detergent types and concentrations

      • Use of solubilizing tags (e.g., SUMO, MBP) in addition to His-tag

      • Sequential extraction protocols with increasing detergent strengths

  • Proper Folding and Conformation:

    • Challenge: Maintaining native conformation during expression in heterologous systems like E. coli

    • Solution Approaches:

      • Expression at lower temperatures (16-18°C)

      • Inclusion of molecular chaperones as co-expression partners

      • Use of eukaryotic expression systems for more complex post-translational modifications

  • Mitochondrial Targeting and Processing:

    • Challenge: Recombinant TMEM11-A may require specific processing of mitochondrial targeting sequences

    • Solution Approaches:

      • Design of constructs with and without predicted targeting sequences

      • Co-expression with mitochondrial processing peptidases

      • Verification of proper N-terminal processing by mass spectrometry

  • Preservation of Functional Activity:

    • Challenge: Maintaining protein activity during purification and storage

    • Solution Approaches:

      • Optimization of buffer conditions:

        • pH range testing (typically 7.0-8.0)

        • Inclusion of stabilizing agents (6% Trehalose has been reported effective)

        • Addition of reducing agents to prevent oxidation of cysteine residues

      • Proper reconstitution protocols after lyophilization

  • Quality Control Parameters:

    • Purity assessment by SDS-PAGE (>90% purity recommended)

    • Activity assays to confirm functional status

    • Storage recommendations:

      • Avoid repeated freeze-thaw cycles

      • Store working aliquots at 4°C for up to one week

      • Long-term storage at -20°C/-80°C with 5-50% glycerol (50% being optimal)

Successfully addressing these challenges requires a systematic optimization approach, often specific to the intended downstream application of the purified protein.

How do functional studies of TMEM11-A in Xenopus laevis compare with findings in mammalian models?

Comparative analysis of TMEM11-A function between Xenopus laevis and mammalian models reveals both conserved and divergent aspects:

  • Conserved Molecular Interactions:
    Both amphibian and mammalian TMEM11 proteins interact with the methyltransferase METTL1, suggesting this regulatory mechanism is evolutionarily conserved. This conservation extends to the downstream effectors in the signaling pathway, where ATF5 represents a common target in both systems .

  • Tissue-Specific Functions:

    AspectXenopus laevisMammalian Models
    Neural RegenerationTMEM11-A regulates mitochondrial dynamics during spinal cord regenerationLimited regenerative capacity in spinal cord; TMEM11 studied primarily in other contexts
    Cardiac FunctionLess extensively studiedTMEM11 suppresses cardiomyocyte proliferation and influences cardiac repair
    Metabolic AdaptationTransient glycolytic shift in neural tissues after injurySimilar metabolic shifts observed in various tissues during stress response
  • Regenerative Capacity Differences:
    The most striking difference between these models is their inherent regenerative capacity. Xenopus laevis possesses remarkable spinal cord regenerative abilities, with TMEM11-A participating in the transient metabolic shift toward glycolysis that facilitates this process . In contrast, mammals have limited regenerative capacity, particularly in neural tissues, though TMEM11 has been implicated in cardiac regeneration pathways .

  • Experimental Advantages of Each Model:

    • Xenopus laevis Advantages:

      • Naturally occurring regenerative processes

      • Easily visualized developmental stages

      • Transgenic lines with fluorescent reporters for specific cell populations

      • Evolutionary position allowing distinction between conserved and species-specific adaptations

    • Mammalian Model Advantages:

      • Closer physiological relevance to human conditions

      • More extensive genetic tools available

      • Better characterized signaling pathways

      • Established disease models

  • Translational Implications:
    Understanding how TMEM11-A functions in the highly regenerative context of Xenopus laevis provides valuable insights that can potentially be applied to enhance limited regenerative processes in mammals. The conserved TMEM11-METTL1-ATF5 axis identified across species represents a promising therapeutic target for promoting regeneration in human tissues .

This comparative approach highlights the value of studying TMEM11-A across different model organisms to gain comprehensive insights into its fundamental biological functions and potential therapeutic applications.

What experimental approaches could reveal the regulatory mechanisms controlling TMEM11-A expression?

Understanding the regulatory mechanisms controlling TMEM11-A expression would require multi-layered experimental approaches:

  • Transcriptional Regulation Studies:

    • Promoter Analysis:

      • Bioinformatic identification of putative transcription factor binding sites

      • Reporter assays with serial promoter deletions to map regulatory regions

      • ChIP-seq to identify transcription factors binding to the TMEM11-A promoter

    • Epigenetic Regulation:

      • DNA methylation analysis of the promoter region using bisulfite sequencing

      • Histone modification mapping using ChIP-seq for marks like H3K4me3, H3K27ac

      • Chromatin accessibility assessment using ATAC-seq

    • Response Element Characterization:

      • Stimulation experiments with various cellular stressors (hypoxia, metabolic stress)

      • Site-directed mutagenesis of key regulatory elements

      • Single-cell approaches to capture heterogeneity in expression regulation

  • Post-Transcriptional Regulation:

    • miRNA Targeting:

      • Bioinformatic prediction of miRNA binding sites in TMEM11-A mRNA

      • miRNA overexpression and inhibition studies

      • CLIP-seq to map direct RNA-protein interactions

    • RNA Stability Analyses:

      • Actinomycin D chase experiments to measure mRNA half-life

      • Identification of RNA-binding proteins that affect stability

      • Assessment of m7G methylation on TMEM11-A's own transcript

  • Translational and Post-Translational Regulation:

    • Protein Synthesis Control:

      • Polysome profiling to assess translational efficiency

      • Ribosome profiling to map translation initiation sites

    • Protein Modifications:

      • Mass spectrometry to identify phosphorylation, ubiquitination, or other modifications

      • Site-directed mutagenesis of modification sites

      • Inhibitor studies targeting specific modifying enzymes

  • Developmental and Tissue-Specific Regulation:

    • Temporal Expression Profiling:

      • RNA-seq and protein analysis across developmental stages

      • Single-cell RNA-seq to capture cell-type specific regulation

    • Conditional Expression Systems:

      • Tissue-specific promoters controlling TMEM11-A expression

      • Inducible systems to temporally control expression

  • Integration with Cellular Signaling Pathways:

    • Pathway Perturbation:

      • Pharmacological inhibition or activation of major signaling pathways

      • CRISPR screening to identify regulatory factors

      • Phosphoproteomics following pathway stimulation

These approaches would provide complementary insights into the complex regulatory network controlling TMEM11-A expression across different cellular contexts and physiological states.

How might TMEM11-A function be exploited in regenerative medicine applications beyond cardiac tissue?

TMEM11-A's involvement in mitochondrial dynamics and metabolic reprogramming positions it as a potential target for various regenerative medicine applications:

  • Neural Regeneration Applications:

    • Spinal Cord Injury Therapy:
      Building on findings in Xenopus laevis, targeted modulation of TMEM11-A could promote the transient glycolytic shift observed during successful spinal cord regeneration . This approach might involve:

      • Temporally controlled inhibition of TMEM11-A function

      • Delivery of modified TMEM11-A proteins to injury sites

      • Gene therapy approaches to modulate TMEM11-A expression in damaged neural tissues

    • Neurodegenerative Disease Treatment:
      Since mitochondrial dysfunction is implicated in conditions like Alzheimer's and Parkinson's diseases, TMEM11-A modulation could potentially:

      • Restore proper mitochondrial morphology and distribution

      • Enhance bioenergetic function in compromised neurons

      • Promote neural stem cell activation and differentiation

  • Metabolic Tissue Regeneration:

    • Liver Regeneration Enhancement:
      The liver's regenerative capacity relies heavily on metabolic reprogramming similar to that observed with TMEM11-A function:

      • Promoting transient glycolysis in hepatocytes after injury

      • Enhancing proliferative capacity during regenerative phases

      • Supporting mitochondrial remodeling during tissue regrowth

    • Pancreatic β-cell Regeneration:
      Diabetes therapies could potentially benefit from TMEM11-A modulation to:

      • Enhance β-cell proliferation through the TMEM11-METTL1-ATF5 pathway

      • Optimize mitochondrial function for insulin secretion

      • Support metabolic adaptations during regenerative processes

  • Skeletal Muscle Regeneration:

    • Injury Recovery Acceleration:
      Modulating TMEM11-A could enhance myoblast proliferation and differentiation through:

      • Temporal control of cell cycle regulation via the ATF5-INCA1 axis

      • Metabolic support during different phases of muscle regeneration

      • Optimization of mitochondrial networks during myofiber formation

    • Age-Related Sarcopenia Treatment:
      TMEM11-A targeting could potentially address:

      • Declined satellite cell activation in aging muscle

      • Impaired mitochondrial quality control

      • Compromised metabolic flexibility

  • Engineering Approaches:

    • Biomaterial Integration:
      TMEM11-A modulators could be incorporated into:

      • Controlled-release scaffolds for tissue engineering

      • Injectable hydrogels for targeted delivery to injury sites

      • Nanoparticle formulations for cell-specific targeting

    • Ex Vivo Tissue Engineering:
      Manipulation of TMEM11-A in cultured cells prior to transplantation could:

      • Enhance survival and integration of transplanted tissues

      • Prime cells for optimal regenerative performance

      • Create metabolically optimized tissue constructs

The development of these applications would require systematic validation in mammalian models before clinical translation, but the evolutionary conservation of TMEM11-A function suggests promising potential across vertebrate species.

What are the most significant unresolved questions regarding TMEM11-A function in cellular and organismal physiology?

Despite significant advances in understanding TMEM11-A biology, several critical questions remain unresolved:

  • Structural Biology Questions:

    • What is the three-dimensional structure of TMEM11-A and how does it influence its interaction with mitochondrial membranes?

    • Which specific domains mediate its interaction with METTL1 and other binding partners?

    • How do conformational changes in TMEM11-A regulate its various functions?

  • Regulatory Network Integration:

    • How is TMEM11-A expression and activity regulated across different tissues and developmental stages?

    • What are the upstream signals that modulate TMEM11-A function during regenerative processes?

    • How does TMEM11-A integrate into broader cellular stress response networks?

  • Metabolic Control Mechanisms:

    • What are the precise mechanisms by which TMEM11-A influences the switch between oxidative phosphorylation and glycolysis?

    • How does TMEM11-A communicate between mitochondria and the nucleus to coordinate metabolic adaptation?

    • Are there tissue-specific metabolic roles for TMEM11-A beyond what has been observed in neural and cardiac tissues?

  • Evolutionary Perspective Questions:

    • How has TMEM11-A function evolved across different vertebrate lineages?

    • What aspects of TMEM11-A function are conserved from amphibians to mammals, and which are species-specific?

    • Does the role of TMEM11-A in regeneration correlate with species-specific regenerative capacity?

  • Pathophysiological Relevance:

    • Is TMEM11-A dysfunction implicated in human diseases, particularly those involving mitochondrial dysfunction?

    • Could TMEM11-A genetic variants contribute to differential regenerative capacity among individuals?

    • How might TMEM11-A be targeted therapeutically without disrupting essential physiological functions?

  • Technical Challenges:

    • What are the optimal methods for studying TMEM11-A in its native mitochondrial environment?

    • How can we develop tools to monitor TMEM11-A activity in real-time in living cells?

    • What are the best approaches for selective pharmacological modulation of TMEM11-A function?

Addressing these questions will require interdisciplinary approaches combining structural biology, advanced imaging, genetic manipulation, and systems biology perspectives. The answers will not only enhance our fundamental understanding of TMEM11-A biology but also inform potential therapeutic applications in regenerative medicine.

How can contradictory findings about TMEM11-A function be reconciled across different experimental systems?

Reconciling seemingly contradictory findings about TMEM11-A requires careful consideration of experimental context and methodological approaches:

  • Contextual Factors Influencing Experimental Outcomes:

    • Species Differences:
      Findings from Xenopus laevis may differ from mammalian models due to evolutionary adaptations. While the core functions may be conserved, the regulatory networks and physiological roles could vary significantly between amphibians and mammals .

    • Tissue-Specific Contexts:
      TMEM11-A appears to have distinct functions in neural versus cardiac contexts. In neural tissues, it regulates metabolic shifts during regeneration , while in cardiac tissue, it influences cardiomyocyte proliferation through the METTL1-ATF5-INCA1 axis .

    • Developmental Stage Considerations:
      The function of TMEM11-A may vary across developmental stages, potentially explaining discrepancies between studies using embryonic versus adult tissues.

  • Methodological Reconciliation Approaches:

    • Standardization of Experimental Conditions:

      ParameterRecommendation for Standardization
      Cell TypesClear definition of cell populations (e.g., NSPCs GFP+ vs. non-NSPCs GFP-)
      TimepointsPrecise temporal characterization (e.g., 6 hpt vs. 24 hpt)
      Injury ModelsStandardized lesion protocols with clear anatomical boundaries
      Readout MethodsConsensus metrics for mitochondrial function and morphology
    • Multi-level Analysis Framework:
      Integrating analyses at different biological levels can resolve apparent contradictions:

      • Molecular interactions (protein-protein, protein-RNA)

      • Subcellular localization and dynamics

      • Cellular physiology and metabolism

      • Tissue-level responses

      • Whole-organism phenotypes

  • Technical Considerations for Data Interpretation:

    • Knockout vs. Knockdown Differences:
      Complete knockout models may trigger compensatory mechanisms absent in temporary knockdown approaches, potentially explaining divergent phenotypes .

    • Overexpression Artifacts:
      Protein overexpression can lead to non-physiological interactions or dominant-negative effects that complicate interpretation of TMEM11-A function .

    • Fusion Tag Interference:
      His-tags or fluorescent protein fusions may alter TMEM11-A's localization, stability, or interaction profile .

  • Integrated Data Interpretation Model:
    A comprehensive model of TMEM11-A function should account for:

    • Temporal Dynamics: Different functions may predominate at different timepoints after injury

    • Spatial Regulation: Subcellular localization may determine function

    • Interaction Partners: Tissue-specific binding partners may dictate diverse functions

    • Metabolic Context: The prevailing metabolic state may influence TMEM11-A activity

By systematically addressing these factors, researchers can develop a unified model of TMEM11-A function that accommodates apparently contradictory observations and provides a framework for predicting context-dependent activities of this multifunctional protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.