Recombinant Xenopus laevis Transmembrane protein 11-B, mitochondrial (tmem11-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem11-b; tmem11; Transmembrane protein 11-B, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem11-b
Target Protein Sequence
MATWGRRRAGPGGRERVALAAGECYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPT RIGDETARWISVGNCLHKTAVLSGTACLLTPLALPSEYSHYVSLPAGVLSLACSTLYGIS WQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDMHRKRLHNTIALAALAYCMKK IYELYSV
Uniprot No.

Target Background

Function
This protein plays a role in mitochondrial morphogenesis.
Database Links

KEGG: xla:734799

UniGene: Xl.74633

Protein Families
TMEM11 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Where is tmem11-b expressed in Xenopus laevis?

Tmem11-b is expressed during early development in Xenopus laevis, similar to the expression patterns observed in zebrafish models. While specific expression data for Xenopus laevis is limited in the provided search results, related research in zebrafish indicates that tmem11 splice variants are expressed during early developmental stages. In Xenopus, mitochondrial proteins like tmem11-b are often found in tissues with high energy demands, including the developing brain, notochord, and other neural tissues .

What structural information is available for Xenopus laevis tmem11-b?

A computed structure model of Xenopus laevis tmem11-b is available through AlphaFold DB (AF-Q3B8H3-F1). The model has a global pLDDT (predicted Local Distance Difference Test) score of 80.31, indicating a relatively confident prediction. This model was released in AlphaFold DB on December 9, 2021, and last modified on September 30, 2022. The UniProtKB identifier for this protein is Q3B8H3 .

It's important to note that this is a computational model without experimental verification. Regions with pLDDT scores below 50 may be unstructured in isolation, while regions above 90 have very high confidence. For experimental validation of the structure, techniques such as X-ray crystallography or cryo-electron microscopy would be necessary.

How can recombinant Xenopus laevis tmem11-b be expressed and purified for functional studies?

For the expression and purification of recombinant Xenopus laevis tmem11-b, researchers should consider the following methodological approach:

  • Cloning Strategy:

    • Design PCR primers that encompass the full coding sequence (1-187 amino acids)

    • Include appropriate restriction sites for directional cloning into expression vectors

    • Consider adding a tag (His, FLAG, or GFP) for detection and purification

  • Expression System Selection:

    • For transmembrane proteins, consider using either:

      • Bacterial systems (E. coli) with specialized strains for membrane proteins

      • Eukaryotic systems (insect cells or yeast) for proper folding and post-translational modifications

      • Cell-free expression systems for difficult-to-express membrane proteins

  • Purification Protocol:

    • Solubilize membranes using appropriate detergents (DDM, CHAPS, or Triton X-100)

    • Perform affinity chromatography using the introduced tag

    • Consider size exclusion chromatography for final purification

  • Storage Recommendations:

    • Store in Tris-based buffer with 50% glycerol optimized for protein stability

    • Maintain at -20°C for short-term or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

This approach is based on standard protocols for membrane protein purification and specific information about tmem11-b from available sources.

What methods can be used to study tmem11-b localization in Xenopus laevis cells?

To study tmem11-b localization in Xenopus laevis cells, researchers can employ several complementary approaches:

  • Fluorescent Protein Tagging:

    • Generate constructs with tmem11-b fused to fluorescent proteins (GFP, mCherry)

    • Express in Xenopus cells or embryos via microinjection

    • Visualize using confocal microscopy to determine subcellular localization

  • Biochemical Fractionation:

    • Isolate mitochondria from Xenopus tissues or cells

    • Perform alkaline extraction with carbonate solutions at varying pH (10.5, 11.5, or 12.5)

    • Analyze the distribution between pellet and supernatant fractions

    • For outer membrane localization, treat isolated mitochondria with Proteinase K

    • Analyze by Western blotting using appropriate antibodies against tmem11-b and control markers (TOM20 for outer membrane, COX IV for inner membrane)

  • Immunofluorescence:

    • Generate or obtain specific antibodies against Xenopus tmem11-b

    • Perform immunofluorescence staining on fixed cells or tissue sections

    • Co-stain with mitochondrial markers (MitoTracker, TOM20)

    • Analyze using confocal microscopy

  • Electron Microscopy:

    • Use immunogold labeling with anti-tmem11-b antibodies

    • Perform transmission electron microscopy to visualize precise submitochondrial localization

These methods can be combined to provide robust evidence for the submitochondrial localization of tmem11-b.

How can CRISPR/Cas9 gene editing be optimized for studying tmem11-b function in Xenopus laevis?

Optimizing CRISPR/Cas9 gene editing for tmem11-b in Xenopus laevis requires consideration of several technical factors:

  • Guide RNA Design and Validation:

    • Design multiple sgRNAs targeting early exons of tmem11-b

    • Account for Xenopus laevis' allotetraploidy by identifying conserved regions across homeologs

    • Validate sgRNA efficiency using in vitro cleavage assays before in vivo application

    • Recommended target: Conserved transmembrane domains essential for protein function

  • Delivery Method Optimization:

    • Microinjection into one-cell stage embryos (optimal concentration: 300-500 pg Cas9 mRNA and 50-200 pg sgRNA)

    • For tissue-specific knockout, use tissue-specific promoters to drive Cas9 expression

    • Alternative: ribonucleoprotein (RNP) complex injection for immediate activity

  • Efficiency Assessment Protocol:

    • T7 Endonuclease I assay or TIDE analysis from genomic DNA of F0 embryos

    • Deep sequencing for comprehensive mutation spectrum analysis

    • Western blotting and immunofluorescence to confirm protein reduction

  • Phenotypic Analysis Framework:

    • Assess mitochondrial morphology using live mitochondrial dyes (TMRM, MitoTracker)

    • Measure oxygen consumption rate using Seahorse Extracellular Flux Analyzer

    • Evaluate developmental phenotypes, particularly in neural tissues

    • Examine mitochondrial network using high-resolution confocal microscopy

ParameterRecommended ValueNotes
Cas9 mRNA300-500 pgHigher concentrations may cause toxicity
sgRNA50-200 pgMultiple sgRNAs can be co-injected
Injection timingOne-cell stageFor global knockout
Validation timeline24-48 hours post-fertilizationFor initial assessment
F0 analysisStage 25-47For phenotypic assessment

What are the methodological approaches for investigating tmem11-b's role in mitochondrial dynamics during neural development?

To investigate tmem11-b's role in mitochondrial dynamics during neural development in Xenopus laevis, researchers should consider a multi-faceted approach:

  • Temporal Expression Analysis:

    • Perform RT-qPCR to quantify tmem11-b expression at different developmental stages

    • Use in situ hybridization to map spatial expression patterns in developing neural tissues

    • Conduct Western blot analysis to track protein levels during critical developmental windows

  • Live Imaging of Mitochondrial Dynamics:

    • Inject TMRM (tetramethylrhodamine methyl ester) to visualize mitochondrial membrane potential

    • Perform time-lapse confocal microscopy on developing tadpole brains

    • Quantify parameters such as mitochondrial fusion/fission rates, network complexity, and distribution

  • Functional Mitochondrial Assays:

    • Measure oxygen consumption rate (OCR) using XFe24 Seahorse Extracellular Flux Analyzer

    • Assess ATP production in control versus tmem11-b knockdown conditions

    • Perform mitochondrial stress tests with oligomycin and FCCP to determine respiratory capacity

  • Neural Progenitor Cell Fate Analysis:

    • Use BrdU labeling to track proliferation of neural progenitor cells

    • Perform immunostaining for cell-type specific markers to assess differentiation

    • Employ time-lapse imaging combined with knockdown strategies to visualize cell fate decisions in real-time

  • Molecular Pathway Interrogation:

    • Conduct RNA-seq on neural tissues from control and tmem11-b manipulated tadpoles

    • Perform pathway analysis focusing on mitochondrial and neural development genes

    • Validate key findings using molecular approaches (morpholinos, dominant negatives)

This comprehensive approach would provide insights into how tmem11-b influences mitochondrial function and dynamics in the context of neural development.

How should researchers analyze mitochondrial membrane potential data in relation to tmem11-b function?

Analysis of mitochondrial membrane potential data in relation to tmem11-b function requires rigorous quantitative approaches:

  • Quantification Protocol for TMRM Imaging:

    • Normalize fluorescence intensity to pre-treatment values as baseline (set to 100%)

    • Track temporal changes at regular intervals (e.g., every 5 minutes for 30 minutes)

    • Calculate percent reduction in fluorescence intensity after experimental manipulation

    • Use regression analysis to determine the rate of membrane potential changes

  • Statistical Analysis Framework:

    • Perform repeated measures ANOVA for time-course experiments

    • Use appropriate post-hoc tests (Tukey's or Bonferroni) for multiple comparisons

    • Calculate effect sizes and confidence intervals for robust interpretation

    • Consider hierarchical linear modeling for nested experimental designs

  • Correlation with Functional Outcomes:

    • Create scatterplots correlating membrane potential changes with OCR measurements

    • Perform regression analysis to determine relationships between variables

    • Calculate Pearson's or Spearman's correlation coefficients as appropriate

  • Data Visualization Best Practices:

    • Generate line graphs showing temporal changes in membrane potential

    • Create box plots or violin plots for endpoint comparisons

    • Use heatmaps to visualize spatial patterns of membrane potential in neural tissues

    • Include representative images alongside quantitative data

Example data interpretation table:

TreatmentMembrane Potential Reduction (%)OCR Change (%)Correlation CoefficientStatistical Significance
Control5-10±5--
tmem11-b knockdown50-6030-40 decreaser = 0.85p < 0.001
tmem11-b overexpression20-3015-25 increaser = 0.78p < 0.01
FCCP (positive control)70-8060-70 decreaser = 0.92p < 0.0001

This analytical framework enables robust interpretation of how tmem11-b manipulations affect mitochondrial membrane potential and related functions.

What bioinformatic approaches can reveal evolutionary conservation and functional domains of tmem11-b?

To uncover evolutionary conservation and functional domains of tmem11-b, researchers should implement the following bioinformatic approaches:

  • Sequence Alignment and Phylogenetic Analysis:

    • Perform multiple sequence alignment of tmem11 homologs across species

    • Generate phylogenetic trees to visualize evolutionary relationships

    • Calculate conservation scores for each amino acid position

    • Compare Xenopus laevis tmem11-b with mammalian, zebrafish, and Drosophila homologs

  • Protein Domain Prediction:

    • Identify transmembrane domains using TMHMM, Phobius, or HMMTOP

    • Predict secondary structure elements with PSIPRED

    • Locate conserved motifs using MEME or PRINTS

    • Map conservation onto the AlphaFold structural model (AF-Q3B8H3-F1)

  • Functional Domain Analysis:

    • Use Pfam or InterPro to identify known functional domains

    • Perform hydrophobicity analysis to confirm transmembrane regions

    • Identify potential post-translational modification sites

    • Map regions essential for mitochondrial targeting and membrane insertion

  • Coevolution Analysis:

    • Use methods like PSICOV or EVfold to identify co-evolving residues

    • Map co-evolving networks onto 3D structure

    • Identify potential interaction interfaces with other mitochondrial proteins

    • Predict functional consequences of evolutionary changes

  • Integration with Experimental Data:

    • Compare computational predictions with experimental data on protein localization

    • Validate domain predictions through targeted mutagenesis experiments

    • Design deletion constructs based on predicted domains for functional testing

    • Use evolutionary conservation to guide CRISPR/Cas9 target selection

This multi-layered bioinformatic approach provides a framework for understanding tmem11-b's structure-function relationships and evolutionary context, guiding experimental design for functional studies.

How can tmem11-b be used to investigate mitochondrial involvement in neural progenitor cell fate?

Tmem11-b provides an excellent molecular tool for investigating mitochondrial contributions to neural progenitor cell fate determination:

  • Experimental Design for In Vivo Studies:

    • Generate tmem11-b loss-of-function and gain-of-function tadpoles

    • Employ in vivo time-lapse imaging of neural progenitor cells (NPCs)

    • Track NPC proliferation, differentiation, and migration patterns

    • Correlate mitochondrial morphology changes with cell fate decisions

  • Mitochondrial Activity Monitoring Protocol:

    • Inject TMRM to visualize mitochondrial membrane potential in NPCs

    • Use fluorescent mitochondrial reporters to track network dynamics

    • Perform high-resolution confocal microscopy of the developing brain

    • Quantify changes in mitochondrial distribution during neurogenesis

  • Molecular Mechanistic Investigation:

    • Conduct transcriptomic profiling of neural progenitor cells under different tmem11-b conditions

    • Identify differentially expressed genes involved in neurogenesis

    • Examine potential interactions with known regulators of neural development (e.g., BRCA1, ELK-1)

    • Validate key pathways using targeted knockdown approaches

  • Functional Outcome Assessment:

    • Evaluate neuronal number, morphology, and circuit formation

    • Perform behavioral assays to assess functional consequences

    • Use electrophysiology to measure neuronal activity

    • Correlate cellular phenotypes with molecular and mitochondrial changes

This research approach leverages the established role of mitochondria in neurogenesis and the known functions of tmem11 in mitochondrial dynamics to provide insights into how metabolic regulation influences neural development.

What are the methodological considerations for using recombinant tmem11-b in rescue experiments?

When designing rescue experiments using recombinant tmem11-b, researchers should consider several methodological factors:

  • Construct Design Optimization:

    • Generate rescue constructs with point mutations resistant to knockdown reagents

    • Include epitope tags for distinguishing recombinant from endogenous protein

    • Create domain deletion/mutation variants to test structure-function relationships

    • Consider using inducible expression systems for temporal control

  • Delivery and Expression Protocol:

    • Optimize mRNA concentration (typically 200-800 pg) for microinjection

    • For tissue-specific rescue, use appropriate tissue-specific promoters

    • Time injection to coincide with endogenous expression patterns

    • Validate expression levels by Western blot and immunofluorescence

  • Experimental Controls Framework:

    • Include wild-type uninjected controls

    • Use knockdown-only conditions as negative controls

    • Incorporate knockdown + wild-type tmem11-b rescue

    • Include knockdown + mutant tmem11-b variants

  • Phenotypic Assessment Strategy:

    • Evaluate mitochondrial morphology and membrane potential

    • Measure oxygen consumption rates to assess functional rescue

    • Assess developmental outcomes, particularly in neural tissues

    • Quantify cellular behaviors (proliferation, differentiation, migration)

  • Quantification and Statistical Analysis:

    • Define clear metrics for rescue efficiency

    • Use appropriate statistical tests for comparing multiple conditions

    • Include power analysis to determine sample size requirements

    • Report effect sizes along with p-values for meaningful interpretation

Experimental ConditionSample Size (n)Expected OutcomeMeasured Parameters
Control (uninjected)30-50Normal developmentMortality, morphology, mitochondrial function
tmem11-b knockdown30-50Mitochondrial dysfunctionTMRM intensity, OCR, development
Knockdown + WT rescue30-50Partial/complete restorationRecovery percentage, statistical significance
Knockdown + mutant rescue30-50 (per variant)Variant-dependentDomain-specific functional contribution

This methodological framework enables rigorous assessment of tmem11-b function through rescue experiments, providing insights into structure-function relationships and developmental roles.

What are common challenges in working with recombinant tmem11-b and how can they be addressed?

Researchers working with recombinant tmem11-b may encounter several technical challenges, which can be addressed using the following strategies:

  • Protein Expression and Solubility Issues:

    • Challenge: Low expression yield or protein aggregation

    • Solution: Optimize expression conditions (temperature, induction time)

    • Approach: Use specialized bacterial strains designed for membrane proteins

    • Alternative: Consider eukaryotic expression systems for proper folding

  • Mitochondrial Targeting Efficiency:

    • Challenge: Incomplete or incorrect localization of recombinant protein

    • Solution: Ensure intact N-terminal targeting sequence

    • Approach: Use fluorescent tags on both N- and C-termini to monitor targeting

    • Validation: Perform subcellular fractionation and Western blot analysis

  • Functional Assay Sensitivity:

    • Challenge: Subtle phenotypes that are difficult to detect

    • Solution: Combine multiple assay approaches

    • Approach: Use high-resolution imaging with sensitive dyes like TMRM

    • Analysis: Apply advanced image analysis algorithms for quantification

  • Specificity of Phenotypes:

    • Challenge: Distinguishing direct from indirect effects

    • Solution: Include appropriate controls and rescue experiments

    • Approach: Use acute treatments and time-course analyses

    • Validation: Perform complementary approaches (genetic, pharmacological)

  • Storage and Stability:

    • Challenge: Protein degradation during storage

    • Solution: Store in optimized buffer with 50% glycerol

    • Approach: Aliquot to avoid freeze-thaw cycles

    • Recommendation: Keep working aliquots at 4°C for up to one week

These troubleshooting strategies address common challenges in working with transmembrane mitochondrial proteins like tmem11-b, enhancing experimental success and data reliability.

How can researchers distinguish between direct and indirect effects of tmem11-b manipulation on mitochondrial function?

Distinguishing between direct and indirect effects of tmem11-b manipulation requires a systematic experimental approach:

  • Temporal Analysis Strategy:

    • Perform time-course experiments following tmem11-b manipulation

    • Monitor mitochondrial changes at short intervals (minutes to hours)

    • Compare the timeline of different parameters (membrane potential, morphology, OCR)

    • Direct effects typically manifest rapidly, while indirect effects emerge later

  • Dose-Response Relationship Assessment:

    • Use varying levels of tmem11-b knockdown or overexpression

    • Quantify the relationship between tmem11-b levels and mitochondrial parameters

    • Generate dose-response curves for different outcomes

    • Direct effects often show proportional relationships to protein levels

  • Domain-Specific Mutation Analysis:

    • Create tmem11-b variants with mutations in specific functional domains

    • Express these variants in tmem11-b knockdown background

    • Identify domains essential for different aspects of mitochondrial function

    • Map structure-function relationships through systematic mutation

  • Comparative Pharmacological Approach:

    • Use well-characterized mitochondrial modulators (FCCP, oligomycin)

    • Compare phenotypes with those of tmem11-b manipulation

    • Identify overlapping and distinct effects

    • Establish hierarchy of mitochondrial parameter changes

  • Multi-parameter Analysis Framework:

    • Simultaneously measure multiple mitochondrial parameters:

      • Membrane potential (TMRM fluorescence)

      • Respiratory capacity (OCR measurements)

      • Morphology (network analysis)

      • ROS production

    • Identify primary parameters affected by tmem11-b manipulation

This systematic approach helps establish causality and distinguish primary effects of tmem11-b on mitochondrial function from secondary consequences, enabling more precise interpretation of experimental results.

What are emerging research directions for tmem11-b in developmental neurobiology?

Research on tmem11-b in developmental neurobiology is poised to expand in several innovative directions:

  • Mitochondrial Regulation of Neural Stem Cell Fate:

    • Investigate how tmem11-b-mediated mitochondrial dynamics influence neural progenitor cell decisions

    • Explore the relationship between mitochondrial membrane potential and neurogenesis

    • Examine metabolic reprogramming during neuronal differentiation

    • Connect tmem11-b function to known regulators of neural development

  • Circuit-specific Mitochondrial Requirements:

    • Explore cell type-specific roles of tmem11-b in different neural circuits

    • Investigate how mitochondrial function influences synaptic development and plasticity

    • Examine activity-dependent regulation of tmem11-b expression

    • Assess behavioral consequences of circuit-specific tmem11-b manipulation

  • Environmental Influences and Mitochondrial Adaptation:

    • Study how environmental factors (toxicants, temperature, oxygen levels) affect tmem11-b function

    • Investigate the interaction between sensory experience and mitochondrial dynamics

    • Explore potential protective roles of tmem11-b against mitochondrial toxicants

    • Examine epigenetic regulation of tmem11-b in response to environmental changes

  • Comparative Evolutionary Approaches:

    • Analyze functional conservation and divergence of tmem11 across species

    • Investigate species-specific adaptations in mitochondrial proteins

    • Explore how evolutionary changes in tmem11 relate to brain complexity

    • Leverage the computed structure model (AF-Q3B8H3-F1) for evolutionary insights

These emerging research directions build upon current knowledge while opening new avenues for understanding the fundamental role of mitochondria in neural development and function.

How might tmem11-b research contribute to understanding mitochondrial disorders in human development?

Research on tmem11-b in Xenopus laevis has significant translational potential for understanding human mitochondrial disorders:

  • Model System Advantages:

    • Xenopus provides a vertebrate model with conserved mitochondrial biology

    • External development allows direct observation of embryogenesis

    • High-throughput screening potential for therapeutic compounds

    • Ability to perform tissue-specific manipulations in vivo

  • Mechanistic Insights into Mitochondrial Disorders:

    • Elucidate fundamental mechanisms of mitochondrial dynamics

    • Identify molecular pathways linking mitochondrial dysfunction to developmental abnormalities

    • Understand tissue-specific vulnerabilities to mitochondrial impairment

    • Discover compensatory mechanisms that might be therapeutically relevant

  • Neurodevelopmental Disorder Connections:

    • Explore how mitochondrial dysfunction contributes to neurodevelopmental disorders

    • Investigate the relationship between energy metabolism and neural circuit formation

    • Assess how mitochondrial protein defects affect brain development

    • Identify sensitive periods when mitochondrial function is most critical

  • Therapeutic Strategy Evaluation:

    • Test potential therapeutic approaches in a developmentally relevant context

    • Screen compounds that modulate mitochondrial function

    • Evaluate gene therapy approaches for mitochondrial disorders

    • Assess the efficacy of metabolic interventions during different developmental windows

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.