Recombinant Xenopus laevis Transmembrane protein 129 (tmem129)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem129; E3 ubiquitin-protein ligase TM129; RING-type E3 ubiquitin transferase TM129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-362
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem129
Target Protein Sequence
EFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSSATLLAHSLLPMGYFIGMCFAAPEKELY NVHKAADGWKVFVLMAVLLPIATSILAFYWSQKRWSNHPLAKTLAHHALPQSSWRAVASS INTEFRRIDKFATGAPSARVIVTDTWVMKVTTYKVDVAQQQDIHLTVTDSRQHELSPDSN TPVQFITIRVASINPRVKPFDIRLNSTEYGELREKLHAPIRNAANIVIHQTLGDMFLDTF RSLVEANHTYEISSNQELEPCIGCMQTNANIKLVKYCQEANEGECQQCYCRPMWCLTCMG KWFASRQDQQHPETWLSSQVPCPTCRAKFCIVDVCIVR
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase involved in ER-associated protein degradation; preferentially associates with the E2 enzyme UBE2J2.
Database Links

KEGG: xla:432097

UniGene: Xl.5958

Protein Families
TMEM129 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Xenopus laevis TMEM129?

TMEM129 is an evolutionarily conserved, polytopic membrane protein with a unique topology. Experimental validation through glycosylation scanning mutagenesis and other techniques has revealed that TMEM129 contains:

  • Three transmembrane domains with an N-exo-C-cyto orientation

  • A non-glycosylated protein structure

  • A non-cleaved signal anchor sequence

  • A C-terminal RING domain positioned in the cytosol

The protein's fundamental structure is well-conserved across species, with TMEM129 being traceable back to the unicellular metazoan ancestor Capsaspora owczarzaki . In Xenopus laevis specifically, the protein maintains this conserved structure while exhibiting species-specific amino acid variations.

What is the functional role of TMEM129 in cellular processes?

TMEM129 functions as an E3 ubiquitin ligase involved in endoplasmic reticulum-associated degradation (ERAD). Specifically:

  • It helps target misfolded secretory proteins across the ER membrane back to the cytosol for proteasomal degradation

  • It preferentially associates with the E2 enzyme UBE2J2 for substrate ubiquitination

  • It contains an unusual RING-C2 domain (with only cysteine, no histidine residues for zinc coordination) that is critical for its ligase activity

Research has demonstrated that TMEM129 is a rate-limiting protein for processes such as viral-mediated MHC-I dislocation and degradation, highlighting its importance in protein quality control pathways .

What are the optimal conditions for expressing recombinant Xenopus laevis TMEM129?

For expressing recombinant Xenopus laevis TMEM129, multiple expression systems have been documented with varying advantages:

E. coli Expression System:

  • Commonly used for producing His-tagged TMEM129 protein

  • Typically involves full-length expression (amino acids 25-362 for Xenopus TMEM129)

  • Yields protein in a lyophilized powder form with >90% purity as determined by SDS-PAGE

Xenopus Oocyte Expression System:

  • Particularly advantageous for functional studies of membrane proteins

  • Utilizes microinjection of mRNA into oocytes

  • Provides native-like membrane environment and post-translational modifications

  • Protein expression typically peaks 48-72 hours post-injection

  • Allows for co-expression of multiple proteins by co-injection of corresponding mRNAs

The choice between these systems depends on experimental goals (structural vs. functional studies) and required protein modifications.

What purification methods are most effective for isolating Xenopus laevis TMEM129?

For high-purity isolation of recombinant Xenopus laevis TMEM129, affinity purification methods have proven most effective:

From E. coli:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged proteins

  • Recommended storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

From Xenopus Oocytes:

  • Novel affinity purification techniques have been developed specifically for membrane proteins

  • Bergeron et al. demonstrated a method achieving microgram to milligram amounts of correctly folded and highly purified proteins

  • The method involves isolation from plasma membrane fractions followed by detergent solubilization and affinity chromatography

  • This approach allows for structural and functional analyses including negative stain transmission electron microscopy (TEM) and single particle analysis (SPA)

Avoid repeated freeze-thaw cycles as they compromise protein integrity, and store working aliquots at 4°C for no more than one week .

How can recombinant Xenopus laevis TMEM129 be used to study ERAD pathways?

Recombinant Xenopus laevis TMEM129 serves as an excellent model for studying evolutionarily conserved ERAD mechanisms:

Functional ERAD Studies:

  • Expression in cell-free systems derived from Xenopus egg extracts permits reconstitution of ERAD complexes

  • The large-scale proteomics capabilities of Xenopus systems allow identification of TMEM129 interacting partners

  • Enables comparative studies between amphibian and mammalian ERAD pathways to identify conserved and divergent mechanisms

In vitro Ubiquitination Assays:

  • Purified recombinant TMEM129 can be used in reconstituted ubiquitination reactions

  • The activity can be assessed by combining TMEM129 with E1 (UBA1), E2 (preferably UBE2J2), substrate protein, ubiquitin and ATP

  • Formation of poly-ubiquitinated species confirms functional activity

  • RING-less mutants serve as excellent negative controls

These approaches have revealed that TMEM129's ubiquitin ligase activity is dependent on its unusual RING-C2 domain, offering insights into novel mechanisms of ERAD regulation.

What are the advantages of using Xenopus laevis TMEM129 versus human TMEM129 in research?

The choice between Xenopus laevis and human TMEM129 depends on specific research objectives:

Advantages of Xenopus laevis TMEM129:

  • Xenopus expression systems yield robust functional expression and larger quantities of protein

  • The Xenopus oocyte provides a clean background for heterologous expression with minimal interference from endogenous proteins

  • Evolutionary conservation of TMEM129 makes findings relevant to understanding fundamental mechanisms

  • Xenopus embryos offer the advantage of studying developmental regulation of TMEM129 expression

Comparative Advantages:

FeatureXenopus laevis TMEM129Human TMEM129
Expression yieldHigher in Xenopus systemsLower in mammalian systems
Post-translational modificationsNative-like in Xenopus oocytesMost authentic in human cells
Experimental versatilityWell-suited for structural studiesBetter for human disease models
Background interferenceMinimal in Xenopus oocytesHigher in human cell lines

Research has demonstrated that many fundamental properties of TMEM129 are conserved between species, making Xenopus laevis an excellent model for studying fundamental mechanisms of this E3 ligase .

How can site-directed mutagenesis be used to investigate structural features of Xenopus laevis TMEM129?

Site-directed mutagenesis has been instrumental in elucidating key structural features of TMEM129:

Membrane Topology Mapping:

  • Glycosylation scanning mutagenesis has been successfully employed to determine TMEM129's membrane topology

  • This involves inserting glycosylation acceptor sequences at various positions throughout the protein

  • A strategic approach targets predicted loops between transmembrane domains

  • Observation of shifts in protein migration on SDS-PAGE indicates glycosylation, confirming luminal localization of that region

RING Domain Analysis:

  • Mutation of conserved cysteine residues in the unusual C4C4 RING domain

  • Cysteine-to-alanine substitutions at zinc-coordinating positions abolish ubiquitin ligase activity

  • Mutation of the predicted E2 binding site (especially the conserved tryptophan residue) disrupts E2 recruitment

These approaches have confirmed that Xenopus laevis TMEM129 adopts an N-exo-C-cyto orientation with three transmembrane domains, positioning its catalytically active RING domain in the cytosol .

What techniques are available for studying TMEM129 protein-protein interactions in Xenopus systems?

Several sophisticated techniques have been developed for investigating TMEM129 interactions:

Co-immunoprecipitation in Xenopus Extracts:

  • Xenopus egg extracts provide an excellent biochemical system for studying protein complexes

  • Antibodies against tags (FLAG, HA, or His) on recombinant TMEM129 can be used to isolate complexes

  • Mass spectrometry analysis of co-precipitated proteins reveals interaction partners

  • This approach has identified TMEM129's association with key ERAD components

Proximity Labeling in Xenopus Oocytes:

  • Expression of TMEM129 fused to proximity-labeling enzymes (BioID or APEX)

  • Allows identification of proteins in close proximity to TMEM129 in living cells

  • Can distinguish between stable and transient interactions

Deep Proteomics:

  • Quantitative proteomics using Xenopus egg extracts can identify >11,000 proteins with 99% confidence

  • Protein abundance can be estimated with approximately two-fold precision

  • This approach has been used to study dynamic protein complexes during development and could be applied to TMEM129 interaction networks

These techniques have revealed that TMEM129 participates in ERAD complexes and preferentially associates with the E2 enzyme UBE2J2, supporting its role in protein quality control pathways .

What are common challenges in expressing functional recombinant Xenopus laevis TMEM129?

Researchers frequently encounter several challenges when expressing recombinant TMEM129:

Solubility Issues:

  • As a membrane protein, TMEM129 can aggregate during expression and purification

  • Solution: Use mild detergents (DDM, LMNG) during extraction and purification

  • Avoid harsh detergents that may denature the protein's structure

  • Consider fusing with solubility-enhancing tags (MBP, SUMO) that can be later removed

Protein Misfolding:

  • Transmembrane proteins often misfold when overexpressed

  • Solution: Lower expression temperature (16-18°C) to slow protein synthesis

  • Expression in Xenopus oocytes provides cellular machinery for proper folding

  • Incorporate chaperone co-expression strategies to improve folding

Functional Assessment Challenges:

  • Verifying enzyme activity of purified TMEM129

  • Solution: Establish in vitro ubiquitination assays using purified components

  • Include positive controls (known active E3 ligases) and negative controls (RING-less mutants)

These challenges can be addressed through optimization of expression conditions and careful selection of experimental systems based on research objectives.

How can researchers validate the structural integrity of purified Xenopus laevis TMEM129?

Multiple complementary approaches can be used to verify structural integrity:

Biophysical Characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm correct oligomeric state

  • Thermal shift assays to evaluate protein stability

Functional Validation:

  • In vitro ubiquitination assays to confirm enzymatic activity

  • The capacity to poly-ubiquitinate model substrates indicates properly folded RING domain

  • Co-immunoprecipitation with known binding partners (e.g., UBE2J2) verifies interaction surfaces

Structural Analysis:

  • Negative stain transmission electron microscopy (TEM) and single particle analysis (SPA) can reveal quaternary structure

  • These techniques have been successfully applied to membrane proteins purified from Xenopus oocytes

  • 2D crystallization trials can serve as indicators of structural integrity, as demonstrated for other membrane proteins expressed in Xenopus systems

Proper validation ensures that experimental observations reflect the protein's native properties rather than artifacts of misfolding.

How is TMEM129 research contributing to understanding viral evasion mechanisms?

TMEM129 has emerged as a key player in viral immune evasion strategies:

Human Cytomegalovirus (HCMV) Evasion:

  • HCMV protein US11 hijacks TMEM129 to downregulate MHC-I molecules

  • This process requires TMEM129's E3 ligase activity and association with UBE2J2

  • Depletion of TMEM129 prevents HCMV-induced MHC-I degradation

  • This mechanism helps infected cells evade recognition by cytotoxic T-lymphocytes

Comparative Biology Insights:

  • Studying Xenopus TMEM129 provides evolutionary context for viral evasion mechanisms

  • Conservation of TMEM129 structure suggests fundamental importance in cellular processes

  • Differences between amphibian and mammalian TMEM129 may reveal species-specific vulnerabilities to viral manipulation

This research direction highlights how basic studies of TMEM129 contribute to understanding complex host-pathogen interactions and may inform antiviral therapeutic strategies.

What are emerging techniques for studying TMEM129 dynamics in real-time?

Cutting-edge approaches are enabling unprecedented insights into TMEM129 dynamics:

CRISPR-based Genome Engineering in Xenopus:

  • Recent advances in CRISPR/Cas9 editing of Xenopus genomes

  • Allows tagging of endogenous TMEM129 with fluorescent proteins or epitope tags

  • Enables study of physiological expression levels and native interactions

Advanced Imaging in Xenopus Oocytes:

  • Super-resolution microscopy of fluorescently tagged TMEM129 in oocyte membranes

  • Single-molecule tracking to monitor diffusion and interactions with ERAD components

  • Fluorescence recovery after photobleaching (FRAP) to examine protein mobility

Quantitative Proteomics for Dynamic Interaction Mapping:

  • Time-resolved proteomics in Xenopus egg extracts can identify >9,000 proteins

  • Protein abundance can be monitored with ~2-fold precision

  • This approach can track dynamic changes in TMEM129 interaction networks under varying conditions

These emerging techniques promise to transform our understanding of TMEM129 biology by capturing the dynamic nature of its interactions and functions in living systems.

What electrophysiological approaches can be used to study TMEM129-associated membrane properties?

Although TMEM129 itself is not an ion channel, electrophysiological techniques can provide valuable insights into its membrane environment and effects on associated proteins:

Two-Electrode Voltage Clamp (TEVC):

  • The large size of Xenopus oocytes makes them ideal for TEVC recordings

  • Can examine how TMEM129 expression affects membrane properties or co-expressed channels

  • TEVC has been used extensively with Xenopus oocytes for characterizing membrane proteins

Patch Clamp Recording:

  • More detailed analysis of membrane properties in Xenopus oocytes expressing TMEM129

  • Can detect subtle changes in membrane conductance related to protein degradation processes

  • Particularly valuable when studying how TMEM129-mediated degradation affects ion channels or transporters

These electrophysiological approaches complement biochemical and imaging studies, providing functional readouts of TMEM129's effects on the membrane proteome.

How can quantitative proteomics be leveraged to study TMEM129-dependent protein degradation?

Advanced proteomics techniques offer powerful approaches to study TMEM129's role in protein degradation:

SILAC or TMT-based Quantitative Proteomics:

  • Xenopus systems are compatible with multiplexed proteomics experiments

  • Can identify >11,000 proteins with 99% confidence from Xenopus egg extracts

  • Protein abundance can be estimated with approximately two-fold precision

Degradation Profiling Workflow:

  • Express wild-type or catalytically inactive TMEM129 in Xenopus oocytes

  • Collect samples at multiple timepoints

  • Process for quantitative proteomics analysis

  • Identify proteins showing differential abundance patterns

  • Validate potential TMEM129 substrates using independent methods

Data Analysis Approach:

  • Quality control analysis to identify sample preparation errors

  • Control peptide and protein identification error rates

  • Quantify peptide and protein species using the MaxQuant proteomics pipeline

  • Perform clustering and gene-set enrichment analysis to identify functional patterns

This approach has been successfully used to study protein dynamics in Xenopus systems and could reveal the full spectrum of TMEM129's substrates and regulatory targets.

How does Xenopus laevis TMEM129 compare structurally and functionally to homologs in other species?

Comparative analysis reveals both conservation and divergence in TMEM129 across species:

Structural Comparison:

FeatureXenopus laevisHumanMouseChicken
Protein Length362 aa362 aa362 aa362 aa
Transmembrane Domains3333
RING Domain TypeC4C4C4C4C4C4C4C4
Signal AnchorNon-cleavedNon-cleavedNon-cleavedNon-cleaved

The unusual C4C4 RING domain structure is highly conserved across species, suggesting fundamental importance to function .

Functional Conservation:

  • Preferential association with UBE2J2 is maintained across species

  • ERAD functionality appears to be an ancestral trait

  • The protein can be traced back to the unicellular metazoan ancestor Capsaspora owczarzaki

Evolutionary Insights:

  • TMEM129 shows remarkable conservation of structure despite the evolutionary distance between amphibians and mammals

  • No yeast ortholog exists, suggesting TMEM129 emerged after the divergence of metazoans

  • This conservation highlights TMEM129's fundamental importance in cellular quality control mechanisms

Understanding these comparative aspects provides insight into both fundamental ERAD mechanisms and species-specific adaptations.

What unique advantages does the Xenopus model system offer for studying TMEM129 in developmental contexts?

The Xenopus model system provides several distinct advantages for developmental studies of TMEM129:

Large-Scale Embryonic Material:

  • Xenopus females produce thousands of eggs in a single laying

  • Provides abundant material for biochemical and proteomic analysis

  • Enables the study of TMEM129 across developmental stages from egg to tadpole

Manipulable Embryos:

  • Xenopus embryos are readily manipulated for gain and loss-of-function experiments

  • Microinjection of mRNA or morpholino antisense oligonucleotides

  • CRISPR/Cas9 genome editing to create TMEM129 mutants or tagged variants

Genomic Resources:

  • Both X. laevis (allotetraploid) and X. tropicalis (diploid) genomes available

  • EST projects and full-length cDNA sequencing facilitate gene expression studies

  • Xenopus Gene Collection contains TMEM129 cDNAs in expression plasmids

Developmental Expression Profiling:

  • In situ hybridization to track TMEM129 expression patterns during development

  • Deep proteomics across developmental stages has identified >9000 proteins

  • Can correlate TMEM129 expression with specific developmental processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.