Recombinant Xenopus laevis Transmembrane protein 150A (tmem150a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis TMEM150A

Recombinant Xenopus laevis Transmembrane Protein 150A (tmem150a), also known as TMEM150A, TM6P1, or TMEM150, is a synthetic version of a transmembrane protein derived from the African clawed frog (Xenopus laevis). This protein is encoded by the tmem150a gene and functions as an integral component of the plasma membrane, playing roles in phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis and cellular homeostasis . Its recombinant form is widely used in biochemical and immunological studies to investigate membrane-associated processes, immune signaling, and cellular responses to stimuli .

Production and Biochemical Characteristics

The recombinant protein is synthesized using heterologous expression systems, including bacterial (e.g., E. coli), yeast, baculovirus, and mammalian cells, as well as cell-free systems . Key features include:

ParameterDetails
Purity≥85% as determined by SDS-PAGE
Host SystemsE. coli, yeast, baculovirus, mammalian cells, cell-free expression
ApplicationsELISA, Western blotting, SDS-PAGE, functional studies
TagsHis-tag, Strep-tag, Avi-tag, Fc-tag (varies by supplier)
Protein LengthFull-length (25–271 aa) or partial constructs (e.g., AA 1–271)

Partial recombinant proteins (e.g., tmem150a.L for X. laevis) are also available for specialized studies .

Role in Phosphatidylinositol Metabolism

TMEM150A regulates PtdIns(4)P synthesis by modulating the localization of phosphatidylinositol 4-kinase (PI4K) complexes at the plasma membrane . This activity is critical for maintaining lipid membrane composition and cellular signaling .

Immune Signaling and Cytokine Regulation

Knockdown studies in human epithelial cells (e.g., HEK293 and H292) reveal that TMEM150A suppresses TLR4-mediated cytokine production (e.g., CXCL8, IL-6, CCL5) and maintains baseline cytokine homeostasis . For example:

  • TLR4 Activation: In HEK293 cells expressing TLR4, TMEM150A knockdown increased LPS-induced CXCL8 secretion by ~2-fold .

  • Unstimulated Conditions: In H292 cells, TMEM150A depletion elevated cytokine levels even without TLR4 activation, indicating a role in cellular homeostasis .

Immunodepletion and Complementation

In X. laevis egg extracts, recombinant TMEM150A is used to restore protein function after immunodepletion. This method allows precise control over protein concentration, enabling studies of point mutations or domain deletions .

Cell Type-Specific Studies

Translating ribosome affinity purification (TRAP) in X. laevis retina models has identified TMEM150A as a candidate for investigating photoreceptor and retinal ganglion cell biology .

Challenges and Future Directions

While recombinant TMEM150A is invaluable for in vitro studies, challenges include:

  • Translation Efficiency: mRNA-dependent synthesis in X. laevis extracts varies due to extract quality .

  • Functional Validation: Limited data on the protein’s role in non-immune pathways (e.g., autophagy, catabolism) .

Future research should prioritize:

  1. Functional Studies: Testing TMEM150A’s interaction with PI4K and TLR pathways in X. laevis models.

  2. Therapeutic Targets: Exploring its role in diseases linked to lipid metabolism or immune dysregulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
tmem150a; tmem150; Transmembrane protein 150A; Transmembrane protein 150
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-271
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem150a
Target Protein Sequence
VMNHHVCPVENWTYNLTCTDDNTKAGTPKSCCTLEDVPLISKCGTYPPESCLFSLIGNVG AFMVVIICLLRYSQVIEISQRSWLNTTALIAGCTNAAGLVMVGNFQVDYAKSLHYIGAGV AFPAGLLFVCLSSILSYQLAASALDYWLGHLRVSLTIVALISLVLTGVFFIQESFLMQHL VAICEWIFVLDILVFYGTFAYEFGSVSTDTMMAALQSSAARSCKSPGSSSTSTQLHCNAE RIAMI
Uniprot No.

Target Background

Function
Regulates the localization of phosphatidylinositol 4-kinase (PI4K) to the plasma membrane.
Database Links

KEGG: xla:444082

UniGene: Xl.15465

Protein Families
DRAM/TMEM150 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage and handling conditions for recombinant tmem150a to maintain optimal activity?

Recombinant Xenopus laevis tmem150a should be stored in Tris-based buffer with 50% glycerol at -20°C for standard storage, or at -80°C for extended storage periods . For experiments requiring frequent protein usage, working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles.

Avoid repeated freezing and thawing as this significantly reduces protein stability and activity. The recommended concentration for most applications is 50 μg, though this may vary depending on specific experimental requirements . When handling the protein:

  • Perform all manipulations on ice when possible

  • Use sterile technique to prevent contamination

  • Consider adding protease inhibitors for experiments requiring longer incubation periods

  • For functional assays, perform activity tests before experimental use

Storage ConditionTemperatureMaximum DurationNotes
Long-term storage-80°CYearsMinimal activity loss
Standard storage-20°CMonthsRecommended for routine use
Working aliquots4°C1 weekAvoid repeated freeze-thaw
Experimental conditionsRoom temperatureHoursAdd stabilizing agents

What is the spatial and temporal expression pattern of tmem150a during Xenopus development, and how can it be visualized?

The expression pattern of tmem150a in Xenopus development can be characterized using multiple complementary approaches:

In situ hybridization approach: Whole-mount in situ hybridization can be used to detect tmem150a mRNA expression throughout embryonic development. Following established Xenopus protocols, embryos should be fixed overnight in MEMFA, stored in PBTr (1× PBS, 0.1% Triton X-100), and processed using digoxigenin-labeled antisense RNA probes specific to tmem150a . This technique allows visualization of gene expression patterns in intact embryos.

Large-scale expression screens comparable to those performed by Gawantka and colleagues for other Xenopus genes could be employed to identify the spatiotemporal expression pattern of tmem150a . Such screens have previously identified synexpression groups—sets of genes with identical expression patterns that often function in the same molecular pathways.

Immunohistochemistry approach: For protein-level detection, embryos can be fixed, sectioned at 10μm, and immunostained using antibodies specific to tmem150a. Sections should be washed with PBTr, blocked with 10% goat serum, incubated with primary antibody overnight, washed again, and then incubated with Alexa Fluor-conjugated secondary antibody (1:1000 dilution) for 4 hours . Visualization can be performed using confocal microscopy.

Reporter gene approach: For live imaging of tmem150a expression, transgenic Xenopus embryos expressing fluorescent reporters under the control of the tmem150a promoter can be generated using recently developed efficient transgenic methods in Xenopus .

How can CRISPR/Cas9 be used to study the function of tmem150a in Xenopus laevis?

CRISPR/Cas9 gene editing provides a powerful approach for studying tmem150a function in Xenopus laevis. Despite the allotetraploid nature of the X. laevis genome, recent advances have made targeted gene knockout feasible:

Design of sgRNAs: Single guide RNAs (sgRNAs) targeting tmem150a should be designed using tools such as ZiFit or CRISPRscan to ensure specificity and efficiency . It's crucial to design sgRNAs that target both homeologs (L and S chromosomes) of tmem150a in X. laevis. Targets should be blasted against the genome to ensure uniqueness and evaluated for predicted efficiency scores using CRISPRscan .

Production of sgRNAs: sgRNAs can be produced using PCR-based methods as described by Bhattacharya and colleagues . Here is a general protocol:

  • Design oligonucleotides containing the T7 promoter sequence, the 20-nucleotide target sequence, and the sgRNA scaffold sequence

  • Use PCR to generate templates for in vitro transcription

  • Produce sgRNAs using T7 RNA polymerase

  • Purify the sgRNAs and verify quality by gel electrophoresis

Tissue-specific knockout strategy: To avoid potential early developmental defects, tissue-specific knockout of tmem150a can be achieved by targeted microinjection into selected blastomeres that give rise to tissues of interest . This approach leverages established Xenopus fate maps and avoids the need for generating conditional knockout lines.

Evaluation of knockout efficiency: CRISPR efficiency can be evaluated using:

  • T7 endonuclease assays to detect indels

  • Direct sequencing of PCR amplicons

  • Protein expression analysis using Western blotting

  • Phenotypic analysis of F0 embryos for expected defects

For control experiments, sgRNAs targeting slc45a2 can be used, as knockout of this gene results in albinism without affecting general development .

What are the established protocols for using recombinant tmem150a in regeneration studies with Xenopus tadpoles?

Recombinant tmem150a can be used in regeneration studies following protocols similar to those established for other secreted proteins in Xenopus. Based on comparable studies with proteins like Ag1:

Preparation of experimental solution: Recombinant tmem150a should be added to 0.1 MMR (Marc's Modified Ringer's) solution to a final concentration of 3 μg/ml for optimal activity . Control experiments should use the same concentration of bovine serum albumin (BSA) in identical conditions.

Tail regeneration assay protocol:

  • Amputate the distal 1/3 of the tadpole tail at stage 40-42 using a sterile scalpel

  • Immediately transfer tadpoles to dishes containing 50 ml of 0.1 MMR with 3 μg/ml recombinant tmem150a

  • Maintain at 18-22°C and document regeneration daily for 7 days

  • Change the solution containing the recombinant protein every 24-48 hours

  • Quantify regeneration by measuring the length and area of the regenerated tail

Protein integrity monitoring: To ensure continued protein activity throughout the experiment, samples of the solution should be collected daily and tested for protein integrity using methods such as Western blotting or functional assays .

Data analysis: Compare regeneration rates and morphology between tmem150a-treated tadpoles and controls, quantifying parameters such as:

  • Blastema formation timing

  • Regeneration rate (mm/day)

  • Final regenerate size and morphology

  • Cell proliferation (using EdU incorporation)

  • Gene expression changes in the regenerating tissue

How can transmembrane potential measurements be integrated with tmem150a functional studies?

Integrating transmembrane voltage potential (Vmem) measurements with tmem150a functional studies can provide insights into the relationship between membrane properties and tmem150a activity. Based on established protocols for studying membrane potentials in Xenopus:

Membrane potential visualization: Use voltage-sensitive dyes such as DiBAC4(3) or CC2-DMPE with embryos or explants expressing or treated with recombinant tmem150a . The protocol involves:

  • Incubating samples in voltage-sensitive dye solution (typically 0.5-2 μM)

  • Washing to remove excess dye

  • Imaging using fluorescence microscopy with appropriate filters

  • Quantifying fluorescence intensity as a measure of membrane potential

Electrophysiological measurements: For precise measurements of membrane potential changes:

  • Perform patch-clamp recordings on cells expressing tmem150a or treated with recombinant protein

  • Use two-electrode voltage clamp for Xenopus oocytes expressing tmem150a

  • Measure changes in resting membrane potential and membrane conductance

Experimental design for causality testing:

  • Express tmem150a in Xenopus embryos or explants

  • Manipulate membrane potential using ion channel modulators or by altering extracellular ion concentrations

  • Measure changes in tmem150a expression, localization, or activity

  • Conversely, modulate tmem150a levels and measure resulting changes in membrane potential

Analysis of Vmem-dependent phenotypes: Document changes in cell behavior, morphogenesis, or gene expression that correlate with both tmem150a activity and membrane potential alterations .

What are the technical challenges and solutions when comparing tmem150a function between Xenopus laevis and Xenopus tropicalis models?

Comparing tmem150a function between Xenopus laevis and Xenopus tropicalis presents several technical challenges due to their genomic differences:

Genomic complexity considerations:

  • X. laevis has an allotetraploid genome with two homeologs for many genes, while X. tropicalis has a diploid genome

  • Sequence divergence between orthologs requires species-specific primers and antibodies

  • Expression levels of tmem150a may differ between species, requiring normalization strategies

Experimental solutions:

  • Design species-specific primers that account for sequence differences when performing RT-PCR or qPCR

  • When using CRISPR/Cas9, design sgRNAs that either target conserved regions (for comparative studies) or species-specific regions (for species-specific knockout)

  • Use appropriate controls for each species, considering their different developmental rates and temperature preferences

  • Account for size differences between embryos when dosing recombinant proteins

Standardization approach for comparative studies:

ParameterX. laevisX. tropicalisStandardization Solution
Development rateSlowerFasterStage-match rather than time-match
Optimal temperature18-22°C25-28°CUse species-appropriate temperatures
GenomeAllotetraploidDiploidTarget both homeologs in X. laevis
Generation time1-2 years4-6 monthsX. tropicalis preferred for genetic studies
Embryo sizeLargerSmallerAdjust microinjection volumes proportionally

How can researchers resolve contradictory findings regarding tmem150a function in different experimental contexts?

When facing contradictory results regarding tmem150a function across different experimental contexts, researchers should implement a systematic approach to resolve discrepancies:

Source analysis: Evaluate potential sources of variability:

  • Different protein tags (His, GST, etc.) may affect protein folding or function

  • Expression systems (bacterial, insect, mammalian) can result in different post-translational modifications

  • Storage conditions affect protein stability and activity over time

  • Experimental readouts may have different sensitivities or specificities

Methodological reconciliation approach:

  • Standardize protein preparation: Use consistent expression systems and purification methods

  • Validate protein activity: Develop functional assays to confirm activity before experiments

  • Use multiple complementary techniques: Combine genetic approaches (CRISPR, morpholinos) with protein-based approaches (recombinant proteins)

  • Control for developmental stage: Different results may reflect stage-specific functions

Systematic validation protocol:

  • Perform dose-response experiments to identify optimal concentrations

  • Test specificity using competitive binding assays

  • Include appropriate positive and negative controls

  • Verify phenotypes using rescue experiments with wild-type protein

Collaborative resolution strategy:
When different labs report contradictory findings, organize a multi-laboratory study with standardized protocols to identify sources of variability and establish consensus on tmem150a function.

What are the most promising research directions for understanding tmem150a's role in developmental signaling networks?

Future research on tmem150a should focus on integrating this protein into known developmental signaling networks:

Integration with established developmental pathways: Investigate potential interactions between tmem150a and key signaling pathways in Xenopus development, including:

  • TGFβ/BMP signaling, which is crucial for embryonic induction and patterning

  • FGF signaling pathways that regulate morphogenesis and organogenesis

  • Wnt signaling networks that control axis formation and tissue specification

Systematic interactome analysis: Employ techniques to identify tmem150a interaction partners:

  • Immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screening using cytoplasmic domains

  • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins

  • Genetic interaction screens using CRISPR technology

Evolutionary context exploration: Compare tmem150a function across species to understand evolutionary conservation:

  • Analyze structural and functional conservation between amphibian and mammalian orthologs

  • Identify species-specific features that may relate to unique developmental processes

  • Use phylogenetic analysis to predict functional domains based on evolutionary conservation

Integration with genome-wide approaches:

  • Perform RNA-seq analysis of tmem150a knockouts at different developmental stages

  • Use ChIP-seq to identify transcription factors regulating tmem150a expression

  • Employ proteomics approaches to identify post-translational modifications of tmem150a

These research directions will help place tmem150a within the broader context of developmental biology and may reveal new therapeutic targets for human diseases related to these signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.