Recombinant Xenopus laevis Transmembrane protein 150B-A (tmem150b-a)

Shipped with Ice Packs

In Stock

Cat. No.

BT2121031

Source

in vitro E.coli expression system

Synonyms

tmem150b-a; Modulator of macroautophagy TMEM150B-A; Transmembrane protein 150B-A

Quick Inquiry

Description

Amino Acid Sequence and Biochemical Properties

tmem150b-a is a 230-amino acid protein (residues 19–230) with an N-terminal His tag for purification. Its sequence includes hydrophobic regions indicative of transmembrane domains, consistent with its classification as a transmembrane protein.

Feature	Details
Uniprot ID	Q4V7T7
Gene Name	tmem150b-a (Synonyms: Modulator of macroautophagy TMEM150B-A)
AA Sequence	IWIVYGMSVSNGSVNLSDGFPYISLCGTDPPQSCVFGQVLNVGAMLGVWISAIRFQQIRD YNCHSVLNSVSLAMGILCALGTSIVGNFQQSNQLETHLAGAFLAFVIGNIYFWMQTALTY MVKPTHGGCYIGPIRFCLSVACTALIVLMAVFLKMNMKSISAICEWIVAMILFLLYGLFA VDFWHLDGHYFHVKKRTVIPNEMQVSTVTLSI
Tag	N-terminal His tag
Purity	>90% (SDS-PAGE)
Form	Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Regulation of BMP Signaling in Xenopus Embryogenesis

tmem150b-a is expressed in the Spemann organizer, a key embryonic structure regulating dorsoventral patterning and axis formation in Xenopus laevis. Key findings include:

BMP Antagonism: tmem150b-a physically interacts with Activin receptor-like kinase 2 (ALK2), a BMP receptor, to inhibit BMP signaling. This interaction is critical for maintaining proper organizer function .
Developmental Impact: Knockdown of tmem150b-a in Xenopus embryos results in head malformations and shortened body axes, underscoring its role in embryonic patterning .

Species-Specific Functional Divergence

While tmem150b-a is vital in Xenopus development, its homolog Tmem150b in mice shows minimal impact on oocyte maturation or fertility:

Mouse Oocyte Studies: Tmem150b knockout mice exhibited normal first polar body extrusion, spindle organization, and follicular development. No defects in fertility or hormone levels were observed .
Potential Redundancy: The lack of phenotype in mice may suggest compensatory mechanisms by paralogs (e.g., DRAM family members) or context-dependent roles .

Key Experimental Uses

Application	Details
BMP Pathway Studies	Investigating ALK2 interaction and BMP signal modulation in organizer tissue .
Embryogenesis Models	Analyzing dorsoventral patterning and axis formation in Xenopus .
Autophagy Modulation	Exploring its role as a modulator of macroautophagy (DRAM family association) .

Comparative Purity

Creative BioMart: >90% purity (SDS-PAGE) .
MyBioSource: ≥85% purity (SDS-PAGE) .

Key Research Findings

Study	Key Observations	Source
BMP Signaling	tmem150b-a binds ALK2 to inhibit BMP signaling in Xenopus.
Mouse Fertility	Tmem150b knockout does not impair oocyte maturation or fertility.
Organizer Function	Knockdown in Xenopus causes head defects and axial shortening.

Product Specs

Form

Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will prepare the product according to your demand.

Lead Time

Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will be applied.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.

Shelf Life

Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it.

Synonyms

tmem150b-a; Modulator of macroautophagy TMEM150B-A; Transmembrane protein 150B-A

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

19-230

Protein Length

Full Length of Mature Protein

Species

Xenopus laevis (African clawed frog)

Target Names

tmem150b-a

Target Protein Sequence

IWIVYGMSVSNGSVNLSDGFPYISLCGTDPPQSCVFGQVLNVGAMLGVWISAIRFQQIRD YNCHSVLNSVSLAMGILCALGTSIVGNFQQSNQLETHLAGAFLAFVIGNIYFWMQTALTY MVKPTHGGCYIGPIRFCLSVACTALIVLMAVFLKMNMKSISAICEWIVAMILFLLYGLFA VDFWHLDGHYFHVKKRTVIPNEMQVSTVTLSI

Uniprot No.

Q4V7T7

Target Background

Function

This protein acts as a modulator of macroautophagy, leading to the accumulation of autophagosomes under basal conditions and enhancing autophagic flux. It inhibits cell death and promotes long-term clonogenic survival of cells grown in glucose-deprived conditions in a macroautophagy-independent manner. It may also play a role in extracellular matrix engulfment or growth factor receptor recycling, both of which can influence cell survival.

Database Links

KEGG: xla:734545

UniGene: Xl.51101

Protein Families

DRAM/TMEM150 family

Subcellular Location

Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Xenopus laevis Transmembrane protein 150B-A (tmem150b-a)

Description

Amino Acid Sequence and Biochemical Properties

Regulation of BMP Signaling in Xenopus Embryogenesis

Species-Specific Functional Divergence

Key Experimental Uses

Comparative Purity

Key Research Findings

Product Specs

Target Background

Quick Inquiry

Category

Service