Recombinant Xenopus laevis Transmembrane protein 177 (tmem177)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xenopus laevis Transmembrane protein 177 (tmem177) is a protein produced in yeast via recombinant technology . TMEM177 in humans plays a role in the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2) and is required for the stabilization of COX20 and newly synthesized COX2 .

Production Sources

Recombinant Xenopus laevis Transmembrane protein 177 (tmem177) can be produced in various expression systems :

  • Yeast

  • E. coli

  • Baculovirus

  • Mammalian cells

Some recombinant versions are also available with an Avi-tag for biotinylation .

Function

TMEM177 is involved in the biogenesis of COX2 and is linked to COX20 abundance . Although TMEM177 is not essential for cytochrome c oxidase activity, its quantity affects COX20 abundance . An imbalance of TMEM177 leads to the accumulation of newly synthesized COX2 in a COX20-associated state . TMEM177 promotes the assembly of COX2 at the CuA-site formation level .

Experimental Methods Involving TMEM177

MethodDescription
Cell CulturingHEK293T Flp-In™T-REX™or HEK293 cells were cultured in DMEM media, supplemented with 10% (v/v) FBS, 2 mM L-glutamine, 1 mM sodium pyruvate, and 50 μg/mL uridine at 37 °C under a 5% CO2 humidified atmosphere .
Generation of Stable Cell LinesStable FLAG-tag TMEM177 and COX20 expressing cell lines were generated according to sequences at the NCBI database: NM_001105198.1 (TMEM177), NM_001312871.1 (COX20) .
Transient TransfectionsPerformed using GeneJuice® (Novagen) according to the manufacturer's instructions .
Mass SpectrometryThe Q Exactive was operated in data-dependent mode. Survey scans were acquired in the range of m/z 375–1700 (resolution 70,000 at m/z 200) with an automatic gain control of 3E6 ions and a maximum fill time of 60 ms . A TOP12 method was employed for higher energy collisional dissociation of multiply charged precursor peptides at a normalized collision energy of 28%, an automatic gain control of 1E6 ions, and a maximum fill time of 120 ms . The dynamic exclusion time for previously selected precursor ions was 45 s . Proteins were identified and quantified using MaxQuant/Andromeda (version 1.4.1.2) .
ImmunofluorescenceImmunofluorescence microscopy was performed on HeLa cells grown on coverslips. Cells were transiently transfected with a plasmid expressing TMEM177FLAG and induced for 12 h . Afterwards, the sample was incubated with MitoTracker red for 5 min. Cells were fixed with 4% paraformaldehyde (PFA) for 20 min at 37 °C, washed with PBS, and permeabilized with 0.2% Triton X-100 for 20 min at room temperature (RT) . Cells were washed once again, and the sample was blocked with 1% BSA (bovine serum albumin) for 20 min at RT and incubated with mouse monoclonal anti-FLAG antibody for 1 h at RT . After washing in PBS, the secondary antibody (Alexa Fluor 488 goat anti-mouse) was applied for 30 min at RT . Following a final wash, the sample was fixed .
Bioinformatics AnalysisPrediction of transmembrane spans of TMEM177 was performed using TMpred (http://www.ch.embnet.org/software/TMPRED_form.html)[1] . A mitochondrial targeting sequence was predicted by MitoProt Server .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet specific needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If a particular tag type is required, please inform us, and we will prioritize its use.
Synonyms
tmem177; Transmembrane protein 177
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem177
Target Protein Sequence
MSSPFLWRFLSFTQKYRGTLLAVSSVGLFAANISYHVAPEQTFRKLYQGWSKGEPVQLTA KLQGLFQEVLEETHMGVTSSYVPFSAFGFHPVSAGIPWLPSGCLIGIPFNYNDTEQDGVG IADRVLLINGKEVDWSSDAGTHLRQALNLSLDAQKFSLAREVFYAQGNSPIIQASAAPVC LSGICLSSVAIKQLLGLYSGPILLRGVYNMAVVVLGFAGYFLCSDAVSQWLDYQSDRKVA AVSKSYATGGIEFYEKILAQNRILRTLMGKQGETMYSPSGNLFPNDYLRLKNAPYTSRRD RIKNALLQME
Uniprot No.

Target Background

Function
This transmembrane protein 177 (TMEM177) plays a critical role in the early stages of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation. It is essential for stabilizing COX20 and the newly synthesized MT-CO2/COX2 protein.
Database Links

UniGene: Xl.20608

Protein Families
TMEM177 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Xenopus laevis tmem177 in cellular processes?

Transmembrane protein 177 (tmem177) in Xenopus laevis plays a critical role in mitochondrial function, specifically in the early steps of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation. Research indicates that tmem177 is required for the stabilization of COX20 and the newly synthesized MT-CO2/COX2 protein . This function positions tmem177 as an essential component in the respiratory chain assembly pathway, contributing to mitochondrial energy production. Studies on mitochondrial transmembrane proteins suggest that tmem177 likely associates with COX20 during COX2 biogenesis in the inner mitochondrial membrane .

How does tmem177 structure relate to its function in Xenopus laevis?

While the complete three-dimensional structure of Xenopus laevis tmem177 has not been fully characterized in the available research, bioinformatic analyses suggest multiple transmembrane domains consistent with its localization to the mitochondrial membrane. The protein's structure facilitates its role in stabilizing nascent COX2 and interacting with COX20 during the assembly of cytochrome c oxidase complexes . By examining similar recombinant transmembrane proteins from Xenopus, researchers can predict that tmem177 likely contains hydrophobic regions that anchor it within the membrane bilayer, positioning it to interact with other components of the respiratory chain assembly machinery .

What expression patterns does tmem177 show during Xenopus development?

Expression analysis of tmem177 during Xenopus development reveals stage-specific patterns consistent with its role in mitochondrial function. The protein appears to be expressed throughout embryonic development, with potentially higher expression in tissues with elevated energy demands such as developing neural tissues, muscle, and heart. Similar to other mitochondrial proteins in Xenopus, tmem177 expression likely increases during periods of active organogenesis when mitochondrial biogenesis is enhanced . Detailed expression data can be accessed through Xenbase, which catalogs developmental stage-specific expression patterns for Xenopus genes .

What are the optimal conditions for recombinant expression of Xenopus laevis tmem177?

For successful recombinant expression of Xenopus laevis tmem177, researchers should consider the following protocol based on successful approaches with similar transmembrane proteins:

Expression ParameterRecommended Conditions
Expression SystemE. coli BL21(DE3) for basic studies; HEK293T or insect cells for functional studies
Vector DesignpET-based with N-terminal His-tag for purification
Induction Conditions0.5-1.0 mM IPTG, 18°C for 16-20 hours (for E. coli)
SolubilizationMild detergents (DDM, LMNG) for membrane extraction
Purification MethodIMAC followed by size exclusion chromatography
Protein YieldExpected 2-5 mg/L culture for E. coli systems

The expression should include appropriate tags for detection and purification, similar to the approach used for tmem163 where His-tagging provided effective purification options while maintaining protein functionality . For mitochondrial membrane proteins like tmem177, mammalian or insect cell expression systems may provide more native-like post-translational modifications essential for functional studies.

How should researchers approach tmem177 knockdown or knockout studies in Xenopus laevis?

For effective functional analysis of tmem177 in Xenopus laevis, researchers can employ multiple targeted approaches:

  • Morpholino oligonucleotides (MOs): Design translation-blocking or splice-blocking MOs targeting tmem177 mRNA. Inject 5-20 ng into 1-2 cell stage embryos, with careful titration to determine optimal concentration.

  • CRISPR/Cas9 genome editing: Design sgRNAs targeting conserved regions of tmem177. Co-inject with Cas9 protein or mRNA into fertilized eggs.

  • Dominant negative constructs: Express truncated or mutated versions of tmem177 that interfere with native protein function.

  • Verification methods: Confirm knockdown efficiency using RT-qPCR, Western blotting, or immunohistochemistry. For CRISPR editing, sequence the targeted region to verify mutations.

These approaches have been successfully applied to study gene function in Xenopus laevis as demonstrated in comprehensive studies of developmental processes and can be adapted specifically for tmem177 analysis . When designing such experiments, researchers should include rescue experiments with wild-type tmem177 mRNA to confirm phenotype specificity.

What are the recommended storage and handling protocols for recombinant tmem177?

To maintain stability and functionality of recombinant Xenopus laevis tmem177:

  • Store lyophilized protein at -20°C/-80°C upon receipt.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to 30-50% final concentration for long-term storage.

  • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce protein activity.

  • For working solutions, store at 4°C for up to one week.

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for optimal stability.

These recommendations are based on established protocols for similar transmembrane proteins from Xenopus laevis . Researchers should validate storage conditions for their specific experimental applications through activity assays before and after storage periods.

How can researchers investigate tmem177 interactions with the mitochondrial respiratory chain assembly machinery?

To elucidate tmem177's protein-protein interactions within mitochondrial complexes:

  • Proximity labeling approaches: Express tmem177 fused to BioID or APEX2 in Xenopus cells or embryos to identify proximal proteins in its native environment.

  • Co-immunoprecipitation: Use epitope-tagged tmem177 to pull down interaction partners, particularly focusing on COX20 and components of cytochrome c oxidase assembly complexes.

  • Crosslinking mass spectrometry: Apply chemical crosslinking followed by mass spectrometry to map interaction interfaces between tmem177 and its binding partners.

  • Blue Native PAGE: Analyze native protein complexes containing tmem177 to determine its incorporation into larger respiratory chain assembly intermediates.

  • Fluorescence resonance energy transfer (FRET): Tag tmem177 and potential interacting proteins with appropriate fluorophores to measure direct interactions in living cells.

This multi-method approach can reveal the dynamic interactions of tmem177 during different stages of cytochrome c oxidase assembly, providing insights into its mechanistic role in mitochondrial function .

How does tmem177 contribute to mitochondrial function during Xenopus development and cellular stress?

To investigate developmental roles and stress responses of tmem177:

  • Stage-specific expression analysis: Quantify tmem177 levels across developmental stages using RT-qPCR and Western blotting, correlating with mitochondrial biogenesis markers.

  • Tissue-specific knockdown: Use targeted injections to deplete tmem177 in specific tissues and assess mitochondrial parameters.

  • Stress response experiments: Expose tmem177-depleted embryos or cells to metabolic stressors (hypoxia, oxidative stress) and assess mitochondrial function using:

    ParameterMeasurement Method
    Mitochondrial Membrane PotentialJC-1 or TMRM staining
    ATP ProductionLuciferase-based assays
    Respiratory Chain ActivityOxygen consumption rate (Seahorse analyzer)
    ROS ProductionCM-H2DCFDA or MitoSOX fluorescence
    Mitochondrial MorphologyConfocal microscopy with MitoTracker staining
  • Rescue experiments: Attempt phenotypic rescue with wild-type tmem177 or human orthologs to assess functional conservation.

These approaches can leverage the advantages of Xenopus as a model system, including the ability to manipulate embryos at specific developmental stages and perform high-resolution imaging of subcellular structures .

What approaches can be used to study the structural dynamics of tmem177 in the mitochondrial membrane?

For advanced structural analysis of tmem177:

  • Cryo-electron microscopy: Purify recombinant tmem177 in native-like membrane environments (nanodiscs or amphipols) for high-resolution structural determination.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map regions of tmem177 that undergo conformational changes upon interaction with binding partners.

  • Single-particle tracking: Express fluorescently-tagged tmem177 in Xenopus cells to track its dynamics within mitochondrial membranes.

  • Molecular dynamics simulations: Use computational approaches to predict tmem177 behavior in lipid bilayers and potential conformational changes during protein-protein interactions.

  • Site-directed spin labeling with electron paramagnetic resonance (EPR): Introduce spin labels at specific residues to measure distances between protein regions during different functional states.

These methodologies can provide insights into how tmem177 structure relates to its function in COX2 maturation and stabilization, potentially identifying critical residues for therapeutic targeting in related mitochondrial disorders .

How conserved is tmem177 across vertebrate species, and what does this reveal about its fundamental role?

Analyzing tmem177 sequence conservation across species provides important evolutionary context:

SpeciesSequence Identity to X. laevisKey Conserved Domains
Human~65-75% (estimated)Transmembrane domains, COX20 interaction motifs
Mouse~60-70% (estimated)Transmembrane domains, COX20 interaction motifs
Zebrafish~55-65% (estimated)Core transmembrane regions
X. tropicalis~85-95% (estimated)Nearly complete conservation

The high conservation of transmembrane domains suggests evolutionary pressure to maintain structure-function relationships critical for mitochondrial respiratory chain assembly. Xenopus laevis offers significant advantages for studying these conserved processes due to its vertebrate physiology and experimental tractability . Researchers can leverage this conservation to translate findings from Xenopus studies to potential applications in human mitochondrial disorders.

How can Xenopus laevis tmem177 research inform our understanding of human mitochondrial disorders?

Xenopus laevis provides an excellent model system for investigating mitochondrial proteins like tmem177 with relevance to human disease:

  • The high degree of conservation between Xenopus and human mitochondrial proteins facilitates translational research.

  • Xenopus embryos allow rapid assessment of phenotypes resulting from tmem177 dysfunction, potentially mimicking human mitochondrial pathologies.

  • Large embryo size facilitates biochemical analysis of mitochondrial function with minimal material.

  • Transparent embryos enable in vivo imaging of mitochondrial dynamics and function.

  • The ability to target specific tissues allows investigation of tissue-specific mitochondrial disorders.

Researchers have successfully used Xenopus to model numerous human genetic disorders, and this approach can be extended to mitochondrial diseases potentially involving tmem177 dysfunction . The experimental advantages of Xenopus, including large embryo size and ease of manipulation, make it particularly valuable for high-throughput screening of potential therapeutic interventions targeting the tmem177 pathway.

What are common challenges in expressing and purifying functional recombinant tmem177, and how can they be addressed?

Researchers often encounter specific challenges when working with transmembrane proteins like tmem177:

  • Low expression yield: Optimize codon usage for expression system; lower induction temperature (16-18°C); use specialized strains designed for membrane protein expression.

  • Protein aggregation: Screen detergents systematically (start with DDM, LMNG, or digitonin); include stabilizing agents like glycerol or specific lipids in purification buffers.

  • Loss of function during purification: Minimize time between cell lysis and purification; maintain detergent above critical micelle concentration throughout all steps.

  • Verification difficulties: Develop activity assays that specifically measure tmem177's ability to stabilize COX20 and COX2; use thermal shift assays to assess protein stability.

  • Reconstitution challenges: For functional studies, reconstitute purified protein into proteoliposomes or nanodiscs containing mitochondrial-like lipid compositions.

These approaches are based on established protocols for similar transmembrane proteins from Xenopus and can be adapted specifically for tmem177 .

How can researchers differentiate between direct and indirect effects when analyzing tmem177 knockdown phenotypes?

To establish causality in tmem177 functional studies:

  • Use multiple independent knockdown/knockout approaches (morpholinos, CRISPR/Cas9) to confirm consistent phenotypes.

  • Perform dose-response experiments with knockdown reagents to establish phenotypic correlation with tmem177 levels.

  • Conduct rescue experiments with:

    • Wild-type tmem177 mRNA (should rescue)

    • Mutated tmem177 lacking key functional domains (should not rescue)

    • Human tmem177 ortholog (to test functional conservation)

  • Employ tissue-specific or inducible knockdown systems to bypass early developmental requirements if tmem177 depletion causes embryonic lethality.

  • Use direct mitochondrial function assays to establish clear links between tmem177 depletion and respiratory chain dysfunction.

These approaches leverage the experimental advantages of Xenopus laevis, including the ability to manipulate gene expression in specific tissues and developmental stages .

What emerging technologies could enhance our understanding of tmem177 function in mitochondrial biology?

Several cutting-edge approaches show promise for advancing tmem177 research:

  • Single-cell transcriptomics and proteomics: Map tmem177 expression patterns at cellular resolution during development and under various stress conditions.

  • In situ cryo-electron tomography: Visualize tmem177 within the native mitochondrial membrane environment at near-atomic resolution.

  • Genome-wide CRISPR screens: Identify genetic interactors and modifiers of tmem177 function in mitochondrial pathways.

  • Optogenetic approaches: Develop light-controlled variants of tmem177 to manipulate its activity with spatial and temporal precision.

  • Patient-derived organoids: Compare tmem177 function in organoids derived from patients with mitochondrial disorders versus healthy controls.

These approaches could significantly advance our understanding of tmem177's role in mitochondrial function and potentially reveal new therapeutic targets for mitochondrial disorders .

How might tmem177 research contribute to therapeutic approaches for mitochondrial disorders?

Translational applications of tmem177 research may include:

  • Small molecule screening: Identify compounds that enhance tmem177 function or compensate for its loss, potentially supporting COX2 maturation in disease states.

  • Gene therapy approaches: Develop targeted delivery systems for functional tmem177 to mitochondria in affected tissues.

  • Biomarker development: Establish whether tmem177 levels or post-translational modifications correlate with specific mitochondrial pathologies.

  • Synthetic biology solutions: Engineer modified versions of tmem177 with enhanced stability or function for therapeutic applications.

  • Metabolic bypasses: Identify alternative pathways that can compensate for defects in the tmem177-dependent assembly of respiratory chain complexes.

Xenopus laevis offers an excellent platform for initial screening and validation of these therapeutic approaches due to its versatility as a model system and the high conservation of mitochondrial processes across vertebrates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.