Recombinant Xenopus laevis Transmembrane protein 178 (tmem178)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Transmembrane Protein 178 (Tmem178)

Recombinant Xenopus laevis Transmembrane protein 178 (Tmem178) is a protein that has garnered attention for its role in various biological processes, particularly those related to calcium regulation, bone homeostasis, and inflammatory responses. Tmem178 is a transmembrane protein, meaning it spans the cell membrane, and it is found in various organisms, including Xenopus laevis, a species of African frog commonly used in biological research . The study of Tmem178 has provided insights into its functions and potential therapeutic applications .

Role in Osteoclast Differentiation and Bone Homeostasis

Tmem178 plays a crucial role in bone homeostasis by negatively regulating osteoclast differentiation . Osteoclasts are cells responsible for bone resorption, and their activity must be tightly controlled to maintain bone mass and prevent excessive bone loss .

  • Negative Feedback Loop: Tmem178 functions in a negative feedback loop, suppressing osteoclast differentiation downstream of PLCγ2 .

  • Bone Volume: Studies on Tmem178-null mice showed a decrease in trabecular bone volume and trabecular thinning, indicating that Tmem178 is essential for maintaining normal bone structure .

  • Inflammatory Osteolysis: Tmem178 restrains inflammatory bone loss, as demonstrated in experiments where Tmem178-null mice suffered more bone loss in models of inflammatory arthritis .

Involvement in Inflammatory Responses

Tmem178 is involved in modulating inflammatory responses, particularly in the context of inflammatory arthritis and systemic inflammation .

  • Response to Inflammatory Cytokines: The addition of TNF-α or LPS exacerbates osteoclast differentiation in Tmem178-deficient cells .

  • Inflammatory Bone Loss: Tmem178-null mice injected with LPS developed profound focal osteolysis, indicating that Tmem178 normally functions to restrain inflammatory bone loss .

  • Association with Arthritis: Reduced Tmem178 expression is associated with augmented osteoclastogenesis in systemic juvenile idiopathic arthritis (sJIA) .

Tmem178 and Asthma

Studies have indicated that TMEM178 expression may serve as a predictor of asthma severity .

VariablesAUC (95% CI)Cutoff pointsSensitivitySpecificityP value
Control from asthmatics0.967 (0.938-0.995)5.42686.7%92.9%<0.001(HS)
Mild from moderate0.870 (0.779-0.961)4.17679.4%80.8%<0.001(HS)
Mild from severe0.991 (0.970-1)2.98297.1%100%<0.001(HS)
Moderate from severe0.950 (0.877-1)2.61792.3%90%<0.001(HS)
CI: confidence interval

P<0.05 is significant

VariableControlled asthma (N=48)partially to uncontrolled asthma (N=22)MWU test (z)P
Mean± SEMean ± SE
TMEM1784.28±0.172.72±0.2724.9<0.001*
FKBP50.51±0.0430.67±0.0492.180.03*
CLCA10.056±0.0050.039±0.0071.970.048*
SERPINB22.59±0.1281.415±0.0845.07<0.001*
Periostin0.114±0.0240.025±0.0044.21<0.001*

P<0.05 is significant

Therapeutic Potential

The involvement of Tmem178 in calcium regulation, bone homeostasis, and inflammatory responses suggests that it could be a potential therapeutic target for various diseases .

  • Osteoporosis and Bone Loss: Modulating Tmem178 activity could help prevent excessive bone resorption and maintain bone density .

  • Inflammatory Arthritis: Targeting Tmem178 might reduce inflammatory bone loss and joint damage in conditions like rheumatoid arthritis .

  • Systemic Inflammation: Regulating Tmem178 expression could help manage systemic inflammation and prevent associated complications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tmem178a; tmem178.1; Transmembrane protein 178A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-304
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem178a
Target Protein Sequence
IFTDHWYETDTRKHKEMCDSQGNSDPTEQKNRLMPLYQLPFRGDPSNTRRLGLLSPAPAG GVREPEDLLENWRSLLGLGVLESDCGRPLFSTYSGLWRKCYIMGIDKDIDSLIIKGIAQK CTAIKYHFSHPIRLRNIPFNLTRAIQQDEWHLLHLRRITAGFLGMAAAVLLCGCIVAAIS FFWEESLTQHVAGLLFLMTGIFCTISLCTYAASVAYELNRQPKFIYGLPSDVEHGYSWSL FCAWCSLGLIVAAGCLCTAYPFISRTKILHLKFARDSCV
Uniprot No.

Target Background

Function
May function as a negative regulator of osteoclast differentiation.
Database Links

KEGG: xla:495141

UniGene: Xl.49104

Protein Families
TMEM178 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein 178 (Tmem178) and what is its significance in Xenopus laevis?

Transmembrane protein 178 (Tmem178) is a protein that spans the cell membrane and plays critical roles in calcium regulation and signaling pathways in Xenopus laevis. This protein has been identified as a novel downstream target of the receptor activator of NF-κB ligand/phospholipase C gamma-2 (PLCγ2) signaling axis . The significance of Tmem178 in Xenopus lies in its involvement in calcium-dependent signaling pathways that are crucial for various developmental and physiological processes.

In contrast to what might be expected from its role downstream of PLCγ2, Tmem178 functions as a negative regulator in feedback loops to maintain homeostasis. Studies in other organisms have shown that Tmem178 localizes to the endoplasmic reticulum (ER) membrane and interacts with calcium sensors like Stim1 to modulate calcium fluxes . Understanding Tmem178 in Xenopus provides insights into evolutionarily conserved signaling mechanisms across vertebrates.

What expression systems are most effective for producing recombinant Xenopus laevis Tmem178?

Several expression systems have been successfully used to produce recombinant Xenopus laevis Tmem178, each with specific advantages depending on research objectives:

  • E. coli expression systems: Often used for partial or non-glycosylated versions of Tmem178. These systems can achieve greater than 85% purity as determined by SDS-PAGE . While cost-effective and high-yielding, bacterial systems may not provide proper post-translational modifications essential for full Tmem178 functionality.

  • Baculovirus/insect cell systems: Demonstrated success in expressing full-length Xenopus transmembrane proteins with proper folding. Studies show that Tmem178 expressed in T. ni cells retains higher ligand-binding activity compared to refolded proteins from bacterial inclusion bodies .

  • Mammalian cell expression: HEK293T cells have been effectively used for expressing full-length Xenopus transmembrane proteins with appropriate post-translational modifications . For Tmem178, this system allows for proper membrane insertion and folding.

  • Cell-free expression systems: These provide a rapid alternative for initial functional studies, though typically with lower yields than cellular systems .

The choice of expression system should be guided by the specific research needs. For structural studies requiring large quantities, bacterial expression followed by refolding can be effective. For functional studies requiring proper protein folding and modifications, insect or mammalian cell systems are recommended.

What are the optimal conditions for refolding Tmem178 from inclusion bodies?

When expressed in bacterial systems, Tmem178 often forms inclusion bodies requiring refolding to obtain functional protein. Based on studies with related Xenopus transmembrane proteins, the following refolding conditions prove most effective:

Refolding Buffer Composition:

  • 50 mM Tris pH 10.0

  • 10 mM CaCl₂

  • 2 mM GSSG (oxidized glutathione)

  • 0.2 mM GSH (reduced glutathione)

  • Either 0.3 M L-arginine OR 0.75 M NDSB-201 (non-detergent sulfobetaine)

Refolding Protocol:

  • Isolate inclusion bodies using strong denaturing conditions (8M urea or 6M guanidine hydrochloride)

  • Perform gradual dilution into refolding buffer (1:10 ratio)

  • Incubate at 4°C for 24-48 hours with gentle stirring

  • Remove aggregates by centrifugation (15,000 × g for 30 minutes)

  • Dialyze against storage buffer

It's important to note that refolded Tmem178 may not exhibit the same level of activity as protein expressed in eukaryotic systems. Comparative studies with related Xenopus transmembrane proteins show that refolded proteins from bacterial inclusion bodies typically retain 30-50% of the activity observed in proteins expressed in insect or mammalian cells .

How can I verify the proper folding and functionality of recombinant Tmem178?

Verification of proper folding and functionality of recombinant Xenopus laevis Tmem178 requires a multi-faceted approach:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure elements

    • Limited proteolysis to confirm compact folding

    • Size exclusion chromatography to assess oligomeric state

  • Calcium-binding functionality:

    • Calcium flux assays using fluorescent indicators like Fura-2

    • Isothermal titration calorimetry (ITC) to measure calcium binding affinity

  • Protein-protein interaction verification:

    • Co-immunoprecipitation with known binding partners such as Stim1

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Immunofluorescence co-localization studies with ER markers

For functional verification specific to Tmem178, examining its ability to modulate calcium signaling is crucial. Based on studies with mammalian Tmem178, proper functionality can be confirmed by testing its ability to regulate NFAT nuclear translocation in response to calcium signals . This can be assessed using reporter assays or direct visualization of NFAT localization via immunofluorescence.

How does Tmem178 regulate calcium signaling in Xenopus laevis cells?

Tmem178 functions as a critical regulator of calcium signaling through its interactions with endoplasmic reticulum (ER) components. Based on comparative studies with mammalian Tmem178, the following mechanism appears conserved in Xenopus:

  • ER localization and Stim1 interaction: Tmem178 localizes to the ER membrane where it binds to Stim1, an ER calcium sensor. This interaction has been confirmed through co-immunoprecipitation and confocal microscopy .

  • Modulation of calcium release: Tmem178 specifically regulates calcium release from ER stores in response to stimuli. Unlike IP3R channels (which it does not directly interact with), Tmem178 appears to function through its binding to Stim1 .

  • Regulation of store-operated calcium entry (SOCE): While Tmem178 interacts with Stim1, it does not directly bind to Orai1 or affect Stim1-Orai1 coupling, suggesting it regulates calcium signaling independently of SOCE mechanisms .

  • Temporal control of calcium oscillations: The presence of Tmem178 affects the frequency and amplitude of calcium oscillations, which are critical for downstream signaling events. In studies of mammalian cells, Tmem178-deficient cells display heightened calcium fluxes and accelerated downstream responses .

This calcium regulatory function appears to be a conserved role of Tmem178 across vertebrates, making findings from Xenopus relevant to understanding general principles of calcium homeostasis in development and disease.

What is the relationship between Tmem178 and NFATc1 signaling pathways in Xenopus?

The relationship between Tmem178 and NFATc1 signaling represents a crucial regulatory axis in calcium-dependent cellular processes. Based on comparative studies:

Tmem178 functions as a negative regulator of NFATc1 activation through its effects on calcium signaling. The mechanism involves:

  • Regulation of calcium fluxes: Tmem178 modulates calcium release from ER stores, affecting the amplitude and duration of calcium signals necessary for NFATc1 activation .

  • Control of NFATc1 nuclear translocation: By modulating calcium oscillations, Tmem178 regulates calcineurin-mediated dephosphorylation of NFATc1, controlling its nuclear translocation. Studies in Tmem178-deficient cells show earlier and sustained NFATc1 nuclear translocation compared to wild-type cells .

  • Impact on NFATc1 target gene expression: Tmem178 deficiency leads to heightened NFATc1 transcript levels and increased expression of NFATc1 target genes. This was demonstrated by increased expression of genes like TRAP (Acp5), Cathepsin K (CtsK), and calcitonin receptor (Calcr) in Tmem178-deficient cells .

  • Feedback regulation: Tmem178 acts in a negative feedback loop to restrain further NFATc1 activation, providing temporal control over calcium-dependent transcriptional responses .

This regulatory relationship appears to be evolutionarily conserved and critical for controlling the magnitude and duration of calcium-dependent gene expression programs across different cell types and species.

How do the functions of Tmem178 in Xenopus compare with its roles in mammalian systems?

Comparative analysis reveals both conserved and divergent aspects of Tmem178 function between Xenopus and mammals:

Conserved Functions:

  • Calcium signaling regulation: In both Xenopus and mammals, Tmem178 localizes to the ER and modulates calcium fluxes through interaction with Stim1 .

  • Negative feedback mechanisms: Tmem178 acts in negative feedback loops to restrain signaling in both systems. In mammals, it specifically limits NFATc1 activation and osteoclast differentiation .

  • ER localization: The subcellular localization to the ER membrane appears consistent across species, suggesting conservation of basic molecular function .

Divergent Aspects:

  • Developmental context: Xenopus undergoes metamorphosis, a process not present in mammals, potentially involving unique roles for calcium regulators like Tmem178 .

  • Immune functions: While mammalian TMEM178 influences immune cell infiltration in disease contexts , its role in the evolutionarily distinct Xenopus immune system may differ.

  • Tissue expression patterns: Preliminary data suggests differences in tissue-specific expression patterns between Xenopus and mammals, possibly reflecting adaptation to different physiological demands.

This evolutionary comparison provides insights into both fundamental calcium regulatory mechanisms and species-specific adaptations, highlighting the value of Xenopus as a complementary model to mammalian systems for understanding Tmem178 biology.

What can studying Xenopus Tmem178 tell us about the evolution of calcium signaling pathways?

Studying Tmem178 in Xenopus provides valuable evolutionary insights:

  • Conservation of core signaling modules: The preservation of Tmem178's role in calcium regulation between amphibians and mammals suggests this represents an ancient and fundamental signaling mechanism. This conservation underscores the importance of calcium homeostasis across vertebrate evolution.

  • Adaptation to different developmental programs: Xenopus undergoes metamorphosis, a calcium-dependent process absent in mammals. Examining Tmem178's role during this transition could reveal how calcium signaling modules were adapted for novel developmental programs throughout evolution.

  • Immune system evolution: Xenopus occupies a phylogenetically important position between aquatic vertebrates and land tetrapods . Its immune system shows both conservation and divergence from mammals, making Tmem178's potential immune roles informative about the evolution of calcium signaling in immunity.

  • Tetraploid genome analysis: Xenopus laevis is tetraploid, with two homeologs of many genes . Comparing the functions of Tmem178 homeologs could provide insights into subfunctionalization and neofunctionalization processes in signaling pathway evolution following genome duplication events.

  • Functional constraint analysis: The pattern of sequence conservation in Tmem178 across species highlights domains under strongest evolutionary constraint, revealing functionally critical regions and interactions that have been maintained over hundreds of millions of years of vertebrate evolution.

How can CRISPR-Cas9 genome editing be utilized to study Tmem178 function in Xenopus laevis?

CRISPR-Cas9 genome editing offers powerful approaches for studying Tmem178 function in Xenopus laevis:

Methodological Approach:

  • sgRNA design considerations for tetraploid genome:

    • Target conserved regions in both L and S homeologs of Tmem178 (tmem178.L and tmem178.S)

    • Use T7 promoter for sgRNA synthesis compatible with Xenopus injection

    • Optimal injection at the one-cell stage with 0.175 ng of tmem178 sgRNA and 0.600 ng of Cas9 protein

  • Knockout verification strategies:

    • T7 endonuclease I assay for initial screening

    • Targeted sequencing of both homeologs

    • Western blot confirmation of protein loss

  • Phenotypic analysis approaches:

    • Calcium imaging using fluorescent indicators in knockout embryos

    • Developmental staging and morphological assessment

    • Cell-type specific effects using tissue-specific promoters

  • Rescue experiments:

    • Co-injection of sgRNA, Cas9, and wild-type Tmem178 mRNA (0.005 ng) to confirm specificity

    • Structure-function analysis using mutated versions of Tmem178

This approach would enable precise dissection of Tmem178 functions during Xenopus development and provide insights into calcium-dependent processes that may be applicable across vertebrates.

How might Tmem178 be involved in DNA replication timing in Xenopus?

Recent research suggests potential connections between calcium signaling proteins and DNA replication timing, raising intriguing possibilities for Tmem178:

  • Connection to Yap signaling pathway: Studies in Xenopus egg extracts demonstrate that Yap (Yes-associated protein 1) regulates DNA replication dynamics through interaction with Rif1, a major regulator of DNA replication timing . Given that calcium signaling affects Yap activity, Tmem178's calcium regulatory function might indirectly influence this process.

  • Potential mechanisms:

    • Calcium oscillations regulated by Tmem178 could affect cell cycle kinase activities

    • Calcium-dependent post-translational modifications might regulate replication factors

    • ER-nuclear envelope connections could provide direct communication between calcium stores and replication machinery

  • Experimental approaches to test involvement:

    • Depletion of Tmem178 in Xenopus egg extracts to assess replication dynamics

    • Comparative analysis of replication timing in control versus Tmem178-depleted embryos

    • Co-immunoprecipitation studies to identify potential interactions between Tmem178 and replication factors

  • Developmental context:

    • DNA replication timing changes dramatically during the midblastula transition in Xenopus

    • The condensed cell cycles of early embryogenesis may involve unique regulatory mechanisms

    • Calcium signaling is known to regulate both cell division and DNA replication in early embryos

This represents an exciting frontier for Tmem178 research, potentially linking calcium signaling with fundamental nuclear processes.

What are promising approaches for studying Tmem178's role in immune function using Xenopus as a model?

Xenopus offers unique advantages for studying Tmem178's role in immune function:

  • Evolutionary perspective on immune system development:

    • Xenopus occupies a key phylogenetic position as a tetrapod with both innate and adaptive immunity

    • Comparison of Tmem178 function between larvae and post-metamorphic frogs provides insights into immune system evolution

    • The Xenopus immune system includes leukocytes involved in innate immunity as well as B and T lymphocytes

  • Methodological approaches:

    • Generation of tissue-specific Tmem178 knockout lines using transgenic techniques

    • Transgenesis using the muscle-specific cardiac actin promoter has been established in Xenopus

    • Morpholino knockdown combined with Trim-Away approach for protein depletion in specific developmental windows

  • Specific experimental designs:

    • Viral challenge studies comparing immune responses in Tmem178-deficient versus control animals

    • Flow cytometry analysis of immune cell populations in knockdown/knockout models

    • Genome-wide studies (RNA-seq, ChIP-seq) to identify Tmem178-dependent gene expression programs in immune cells

  • Potential connections to disease models:

    • Tmem178 expression is associated with immune cell infiltration in human breast cancer

    • Reduced expression correlates with juvenile idiopathic arthritis

    • Xenopus models could provide insights into conserved mechanisms in immune-mediated diseases

This approach would leverage Xenopus's unique advantages as an immunological model while exploring Tmem178's evolving roles across vertebrate lineages.

How can the solubility and stability of recombinant Xenopus Tmem178 be improved for structural studies?

Improving solubility and stability of recombinant Xenopus Tmem178 for structural studies requires addressing several technical challenges:

Optimization Strategies:

  • Expression construct design:

    • Consider expressing only the soluble domains separate from transmembrane regions

    • Create fusion constructs with solubility-enhancing tags (MBP, SUMO, or Thioredoxin)

    • Remove predicted disordered regions that may compromise stability

  • Buffer optimization:

    • Screen detergents systematically (DDM, LMNG, CHAPS) for membrane domain solubilization

    • Include stabilizing additives: 10% glycerol, 50-100 mM arginine/glutamate

    • Optimize ionic strength and pH based on Tmem178's theoretical pI

  • Protein engineering approaches:

    • Introduce strategic disulfide bonds to enhance stability

    • Surface entropy reduction (replace surface clusters of high-entropy residues)

    • Consider thermostabilizing mutations identified through directed evolution

  • Storage considerations:

    • Flash-freeze aliquots in liquid nitrogen with 50% glycerol

    • Store at -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

These approaches have proven successful with other transmembrane proteins from Xenopus and can be tailored specifically for Tmem178 based on its unique biophysical properties.

What are the main challenges in obtaining functional assays for Xenopus Tmem178 and how can they be overcome?

Developing functional assays for Xenopus Tmem178 presents several challenges:

Challenge 1: Membrane protein reconstitution

  • Solution: Utilize liposome reconstitution with Xenopus egg phospholipids to provide native-like membrane environment

  • Alternative: Nanodiscs formed with MSP1D1 scaffold proteins provide a stable membrane mimetic system

Challenge 2: Calcium flux measurement

  • Solution: Establish stable cell lines expressing Xenopus Tmem178 along with calcium sensors (GCaMP6f or Fura-2)

  • Alternative: Develop cell-free assays using liposomes loaded with calcium-sensitive dyes

Challenge 3: Protein-protein interaction analysis

  • Solution: Split-luciferase complementation assays for detecting Tmem178-Stim1 interactions

  • Alternative: Biolayer interferometry with purified components in detergent micelles

Challenge 4: Species-specific binding partners

  • Solution: Use Xenopus egg extracts as a source of native interacting proteins

  • Alternative: Develop proximity labeling approaches (BioID/TurboID) in Xenopus cell lines

Challenge 5: Functional readout in Xenopus systems

  • Solution: Develop calcium imaging protocols optimized for Xenopus embryos and tissues

  • Alternative: Establish reporter systems responsive to NFATc1 activation in Xenopus cells

These approaches address the specific challenges of working with a transmembrane protein from Xenopus while providing quantitative functional readouts applicable to research questions about Tmem178.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.