Recombinant Xenopus laevis Transmembrane protein 184C (tmem184c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem184c; tmem34; Transmembrane protein 184C; Transmembrane protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
tmem184c
Target Protein Sequence
MPCTCGNWRKWIRPLVVLLYILGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPI SLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWIALKYPDIAIYVDTCRECYEAYVI YNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVV RPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPI QPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWKRVQDVATGLQDFIICVEMFLA AVAHHYSFTYKPYVQEAEEGSCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFN DDPEQNEHTSLLSSSTQDPISAASSIPPSPSGHYQGFGQTITPQTTPTAATIPEELYSAD SPEADLQVADHSKVSDDSCNHLDS
Uniprot No.

Target Background

Function
May play a role in cell growth.
Database Links

KEGG: xla:443890

UniGene: Xl.8057

Protein Families
TMEM184 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM184C and what is its known function in Xenopus laevis?

TMEM184C (Transmembrane Protein 184C) is a membrane-spanning protein that appears to function as a possible tumor suppressor and may play a role in cell growth regulation . While extensive research has been conducted on mammalian versions of this protein, studies on the Xenopus laevis ortholog are still emerging. The protein contains multiple transmembrane domains and is encoded by a gene that has been conserved across vertebrate species, suggesting important biological functions. In Xenopus research, TMEM184C is studied for its potential roles in development, cellular signaling, and tissue homeostasis.

Why is Xenopus laevis a suitable model organism for studying TMEM184C?

Xenopus laevis offers several key advantages for TMEM184C research:

  • External fertilization and development allow easy manipulation and observation of embryos

  • Large embryo size facilitates microinjection of constructs and gene editing reagents

  • High embryo yields (up to 4000 eggs per spawning) enable large-scale experiments

  • Transparent tissues surrounding major viscera permit direct visualization

  • Rapid development with most major organs forming within 5 days

  • Well-characterized fate maps and developmental stages

  • Accurate genome sequences are available with well-annotated resources

Additionally, Xenopus systems are particularly valuable for studying proteins involved in developmental processes due to their well-documented embryogenesis and the ability to observe phenotypic effects rapidly.

What are the recommended methods for cloning and expressing recombinant Xenopus laevis TMEM184C?

Cloning Strategy:

  • Extract total RNA from Xenopus laevis tissues (embryos or adult tissues expressing TMEM184C)

  • Perform RT-PCR using primers designed based on the Xenopus laevis TMEM184C sequence (approximately 1512 bp ORF size, based on comparative analysis with rat TMEM184C)

  • Clone the amplified fragment into an appropriate expression vector:

    • For bacterial expression: pET series vectors with appropriate tags

    • For Xenopus expression: Vectors with CMV promoter or tissue-specific promoters

    • Consider including epitope tags (HA, FLAG, His) for detection and purification

Expression Systems:

  • In vitro: Use mRNA synthesis for microinjection into Xenopus embryos

  • Cell-based: Transfect into Xenopus cell lines or mammalian cells

  • Viral vectors: Consider adenoviral constructs similar to those used for rat TMEM184C

For optimal expression in embryos, microinjection of in vitro transcribed capped mRNA at the 1-2 cell stage typically yields robust expression within 6-24 hours.

What are the most effective approaches for studying TMEM184C function in Xenopus laevis?

Loss-of-Function Studies:

  • CRISPR/Cas9 gene editing: Design sgRNAs targeting exonic regions of TMEM184C

    • Inject sgRNAs with Cas9 protein or mRNA into 1-cell stage embryos

    • Screen F0 embryos for mutations using TIDE analysis (effective for achieving >90% mutation rates)

    • Analyze phenotypic consequences during development

  • Morpholino antisense oligonucleotides:

    • Design translation-blocking or splice-blocking morpholinos

    • Validate specificity through rescue experiments

    • Note potential for off-target effects

Gain-of-Function Studies:

  • Overexpression via mRNA injection

  • Transgenic approaches using available driver lines:

    • Consider heat-shock promoter lines for temporal control

    • Tissue-specific promoters for spatial control

Protein Localization and Interaction Studies:

  • Immunohistochemistry with tagged constructs or specific antibodies

  • Co-immunoprecipitation to identify binding partners

  • Live imaging using fluorescent protein fusions

How do the homeologous copies of TMEM184C differ in expression and function between the two subgenomes of Xenopus laevis?

As an allotetraploid species that arose from hybridization approximately 18 million years ago, Xenopus laevis possesses two subgenomes that often show asymmetric gene activation patterns during development . Researchers interested in TMEM184C should consider:

  • Subgenome-Specific Expression Analysis:

    • Perform RNA-seq with subgenome-specific mapping to differentiate between homeologs

    • Use RT-qPCR with primers that can distinguish between homeologous copies

    • Analyze temporal expression patterns during development, particularly during zygotic genome activation

  • Enhancer Architecture Differences:

    • Examine chromatin accessibility profiles using ATAC-seq

    • Perform CUT&RUN for histone modifications to identify potential enhancer regions

    • Analyze transcription factor binding sites that may differentially regulate homeologs

  • Functional Differences:

    • Create homeolog-specific knockouts to assess functional redundancy or specialization

    • Analyze phenotypic differences when one versus both homeologs are disrupted

    • Consider evolutionary conservation by comparing with X. tropicalis ortholog function

Research suggests that despite differential subgenome activation, combined transcriptional output often converges to maintain gene dosage , which may be important for TMEM184C function in development.

What is the role of TMEM184C in pluripotency networks in early Xenopus development?

Given that TMEM184C may function as a tumor suppressor involved in cell growth regulation , investigating its potential role in pluripotency networks is valuable:

  • Expression Correlation with Pluripotency Factors:

    • Analyze co-expression with known pluripotency factors in Xenopus (Pou5f3, Sox3)

    • Examine temporal expression patterns during maternal-to-zygotic transition

  • Chromatin Immunoprecipitation Studies:

    • Determine if TMEM184C is directly regulated by pluripotency transcription factors

    • Map binding sites of Pou5f3 and Sox3 near TMEM184C loci

  • Functional Assessment in Early Development:

    • Perform TMEM184C knockdown specifically during early cleavage stages

    • Analyze impacts on zygotic genome activation markers

    • Assess effects on pluripotency-associated gene networks

  • Comparison with Mammalian Systems:

    • Determine functional conservation with mammalian OCT4/SOX2 regulatory networks

    • Investigate whether TMEM184C is part of conserved or divergent pluripotency programs

What are the challenges in generating antibodies against Xenopus laevis TMEM184C?

Generating specific antibodies against transmembrane proteins like TMEM184C presents several challenges:

  • Protein Structure Considerations:

    • Transmembrane domains are hydrophobic and often poorly immunogenic

    • Extracellular loops may be glycosylated in the native protein

    • Conformational epitopes may be lost in denatured protein preparations

  • Antigen Design Strategy:

    • Focus on hydrophilic regions (extracellular loops or cytoplasmic domains)

    • Synthesize peptides corresponding to unique, accessible regions

    • Consider using recombinant fragments excluding transmembrane domains

  • Cross-Reactivity Concerns:

    • Due to the allotetraploid nature of X. laevis, antibodies may recognize both homeologs

    • Test for cross-reactivity with closely related proteins

    • Validate antibody specificity using TMEM184C knockout/knockdown samples

  • Validation Methods:

    • Western blotting of tagged recombinant protein

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with appropriate controls

How can researchers overcome expression and purification challenges with Xenopus TMEM184C?

Expression Challenges and Solutions:

ChallengeSolution Strategy
Protein toxicityUse inducible expression systems; optimize expression conditions
Low expression levelsTest different promoters; optimize codon usage for expression system
Protein misfoldingCo-express with chaperones; adjust growth temperature
Membrane integrationUse specialized expression hosts for membrane proteins

Purification Approaches:

  • Detergent Screening:

    • Test mild detergents (DDM, LMNG, digitonin) for protein extraction

    • Optimize detergent concentration to maintain protein stability and function

    • Consider detergent exchange during purification steps

  • Affinity Purification:

    • Incorporate purification tags (His, FLAG, etc.) at termini less likely to affect function

    • Use tandem affinity purification for increased purity

    • Consider on-column detergent exchange

  • Quality Control:

    • Size exclusion chromatography to assess monodispersity

    • Circular dichroism to confirm secondary structure

    • Functional assays to verify activity post-purification

How can CRISPR/Cas9 gene editing be optimized for TMEM184C studies in Xenopus laevis?

CRISPR/Cas9 has revolutionized gene editing in Xenopus systems with high efficiency . For TMEM184C studies:

  • sgRNA Design Considerations:

    • Target early exons to ensure functional disruption

    • Design sgRNAs that can target both homeologs if desired

    • Alternatively, design homeolog-specific sgRNAs to study each copy independently

    • Avoid regions with potential off-target sites in the genome

  • Delivery Optimization:

    • Inject Cas9 protein with sgRNA for immediate activity

    • Use nuclear localization-enhanced Cas9

    • Optimize concentrations to minimize toxicity while maintaining editing efficiency

  • Mosaicism Management:

    • Screen multiple F0 embryos due to mosaicism in Xenopus (rapid cell divisions)

    • Use TIDE or NGS to quantify mutation efficiency

    • Consider generating F1 animals for stable lines (although this requires 5-8 months for sexual maturity)

  • Functional Testing:

    • Combine with rescue experiments using mRNA resistant to sgRNA targeting

    • Use tissue-specific or inducible Cas9 systems for temporal control

    • Consider knockin approaches to introduce tags or reporter genes

What are the best approaches for studying TMEM184C protein interactions in Xenopus systems?

Understanding protein interactions is crucial for elucidating TMEM184C function:

  • In vivo Approaches:

    • BioID or TurboID proximity labeling in Xenopus embryos

    • FRET/BRET for studying direct interactions in live embryos

    • Co-immunoprecipitation from embryo lysates followed by mass spectrometry

  • Yeast Two-Hybrid Adaptations:

    • Split-ubiquitin yeast two-hybrid for membrane proteins

    • Use cytoplasmic domains as baits to identify intracellular interactors

  • Cell-Based Assays:

    • Co-IP in Xenopus cell lines (e.g., XTC, XL177)

    • Bimolecular fluorescence complementation (BiFC)

    • APEX2 proximity labeling for membrane protein interactomes

  • Validation in Xenopus Embryos:

    • Co-localization studies using confocal microscopy

    • Genetic interaction assays through combined knockdowns

    • Functional rescue experiments with interaction-deficient mutants

How conserved is TMEM184C function between Xenopus laevis and mammalian systems?

Understanding evolutionary conservation can provide insights into fundamental TMEM184C functions:

  • Sequence Conservation Analysis:

    • Perform multiple sequence alignments across vertebrate species

    • Identify conserved domains and motifs that may be functionally important

    • Analyze conservation between X. laevis homeologs and mammalian orthologs

  • Functional Complementation Studies:

    • Test if mammalian TMEM184C can rescue Xenopus TMEM184C knockdown phenotypes

    • Express Xenopus TMEM184C in mammalian cell systems to assess functional conservation

  • Expression Pattern Comparison:

    • Compare developmental expression timing and tissue distribution

    • Assess conservation of regulatory elements controlling expression

    • Analyze response to similar signaling pathways across species

  • Interactome Conservation:

    • Compare protein interaction networks between species

    • Identify conserved binding partners that may represent core functional complexes

Existing studies suggest strong selection to maintain dosage in core vertebrate pluripotency transcriptional programs , which may include factors interacting with or regulating TMEM184C.

What are promising research avenues for understanding TMEM184C function in Xenopus development and disease models?

Based on the limited but suggestive information about TMEM184C as a potential tumor suppressor and the utility of Xenopus as a model organism, future research could explore:

  • Developmental Role Assessment:

    • Systematic expression analysis across developmental stages and tissues

    • Cell lineage-specific knockout to determine tissue-specific requirements

    • Investigation of potential roles in cell fate decisions or morphogenesis

  • Cancer Model Applications:

    • Develop Xenopus tumor models to study TMEM184C's tumor suppressor function

    • Analyze effects of TMEM184C manipulation on cell proliferation and apoptosis

    • Study interaction with known oncogenic and tumor-suppressive pathways

  • Signaling Pathway Integration:

    • Investigate potential roles in membrane trafficking or receptor signaling

    • Examine effects on well-characterized developmental signaling pathways

    • Study potential interaction with pluripotency factors in early development

  • Technological Innovations:

    • Develop TMEM184C biosensors to monitor activity in live embryos

    • Create conditional knockout systems for stage-specific disruption

    • Establish organoid systems to study TMEM184C in tissue-specific contexts

By leveraging the unique advantages of the Xenopus system, researchers can gain insights into TMEM184C function that may be applicable across vertebrate species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.